BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060768.seq (535 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 23 2.2 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 22 3.9 AM292375-1|CAL23187.2| 311|Tribolium castaneum gustatory recept... 22 3.9 DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc gr... 21 5.2 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 9.0 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 22.6 bits (46), Expect = 2.2 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +1 Query: 67 WTRSRCSIGRTWTGIFFVTLTNKYD 141 WTR+ I + G F+ +LTN ++ Sbjct: 286 WTRNADDISQEEYGEFYKSLTNDWE 310 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 21.8 bits (44), Expect = 3.9 Identities = 10/38 (26%), Positives = 16/38 (42%) Frame = +1 Query: 247 WMXXGEQTTTNDNDAGHSARPKXXVRCQTTTKSXPXLK 360 W+ G+ ++ ND + R Q K+ P LK Sbjct: 125 WLKKGKLSSFESNDETKDGKVGLYERIQKLKKANPSLK 162 >AM292375-1|CAL23187.2| 311|Tribolium castaneum gustatory receptor candidate 54 protein. Length = 311 Score = 21.8 bits (44), Expect = 3.9 Identities = 11/34 (32%), Positives = 15/34 (44%) Frame = +1 Query: 409 KWQSATXVVQVTX*RGNXRSPKRQEFLPNVNXHF 510 +W S Q + N R+ K + F NVN F Sbjct: 45 QWSSLNKNFQFIDKKLNNRNSKSRVFYENVNFQF 78 >DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc growth factor 2 protein. Length = 439 Score = 21.4 bits (43), Expect = 5.2 Identities = 7/30 (23%), Positives = 16/30 (53%) Frame = +1 Query: 328 QTTTKSXPXLKRSKQLVRQHSLNGIHXKWQ 417 +TTT+ + + LV+ + +G+ W+ Sbjct: 127 ETTTRRLAFVNSAYTLVKAYGFDGLDLAWE 156 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 20.6 bits (41), Expect = 9.0 Identities = 5/13 (38%), Positives = 9/13 (69%) Frame = +1 Query: 376 VRQHSLNGIHXKW 414 +R+H+ G+H W Sbjct: 744 LRRHNFKGLHLDW 756 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 104,935 Number of Sequences: 336 Number of extensions: 1990 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12992348 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -