BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060768.seq (535 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1306.02 ||SPBC4.08|WD repeat protein, human WDR6 family|Schi... 26 3.1 SPBP23A10.09 |||GINS complex subunit Psf1 |Schizosaccharomyces p... 25 5.4 SPBP4H10.21c |sld5||GINS complex subunit Sld5|Schizosaccharomyce... 25 9.4 SPAC19D5.07 |uga1||4-aminobutyrate aminotransferase |Schizosacch... 25 9.4 >SPBC1306.02 ||SPBC4.08|WD repeat protein, human WDR6 family|Schizosaccharomyces pombe|chr 2|||Manual Length = 984 Score = 26.2 bits (55), Expect = 3.1 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = +1 Query: 70 TRSRCSIGRTWTGIFFVTLTNKYDAPYSYNYKGT 171 T S SI R+W FFV + Y ++Y+ T Sbjct: 367 TTSDMSIIRSWKNSFFVAAASNKGTIYVFSYQNT 400 >SPBP23A10.09 |||GINS complex subunit Psf1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 202 Score = 25.4 bits (53), Expect = 5.4 Identities = 10/38 (26%), Positives = 17/38 (44%) Frame = -1 Query: 163 YNYSCTVRRICLLTLQKISLSTSGQYCNVSASKFESCI 50 ++ S + CL+ + L QYC + ESC+ Sbjct: 77 FHSSSIYNKRCLMAYHNLRLQRLRQYCWSGGKRMESCL 114 >SPBP4H10.21c |sld5||GINS complex subunit Sld5|Schizosaccharomyces pombe|chr 2|||Manual Length = 214 Score = 24.6 bits (51), Expect = 9.4 Identities = 9/33 (27%), Positives = 18/33 (54%) Frame = +3 Query: 57 DSNLDALTLQYWPDVDRDIFCNVNKQIRRTVQL 155 D + L++ PD+D +FC VN+ + ++ Sbjct: 149 DDKVGNLSMVASPDMDTAVFCVVNESVEENFRV 181 >SPAC19D5.07 |uga1||4-aminobutyrate aminotransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 474 Score = 24.6 bits (51), Expect = 9.4 Identities = 13/38 (34%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = +3 Query: 339 KKXPX-IKTFQTIGSXTFVKWDSXQMAISDXSCASHXI 449 +K P I + G TF+ WD A D CA I Sbjct: 400 RKHPGKINNLRGKGKGTFIAWDCESPAARDKFCADMRI 437 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,787,825 Number of Sequences: 5004 Number of extensions: 29896 Number of successful extensions: 61 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 59 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 61 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 220420454 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -