BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060755.seq (692 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 8e-11 SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) 60 2e-09 SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) 51 1e-06 SB_46680| Best HMM Match : Helicase_C (HMM E-Value=3.8e-22) 47 1e-05 SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) 43 2e-04 SB_43842| Best HMM Match : RNB (HMM E-Value=0) 43 2e-04 SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) 34 0.13 SB_49218| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.89 SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_52637| Best HMM Match : Cpn60_TCP1 (HMM E-Value=0) 30 1.5 SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) 30 2.0 SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) 29 3.6 SB_3046| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_6554| Best HMM Match : Isy1 (HMM E-Value=0) 29 3.6 SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 >SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 790 Score = 64.5 bits (150), Expect = 8e-11 Identities = 27/83 (32%), Positives = 43/83 (51%) Frame = +2 Query: 260 PDWDSVSLQPFXKNFYDPHPTVLKRSPYEVEEYRNKHEVTVSGVEVHNPIQYFEEXNFPD 439 P+ + +PF KNFY+ HP + K+S E+++ R K + VSG P F F + Sbjct: 467 PEKSKIDYKPFNKNFYEEHPEITKQSKQEIDDLRKKMGIKVSGAMPARPCISFAHFGFDE 526 Query: 440 YVQQGVKTMGYKEPTPIQAQGWP 508 + ++ + Y +PT IQ Q P Sbjct: 527 QMMASIRKLEYTQPTQIQCQALP 549 Score = 35.9 bits (79), Expect = 0.031 Identities = 14/24 (58%), Positives = 20/24 (83%) Frame = +3 Query: 543 QTGSGKTLAYILPAIVHINNQPPI 614 +TGSGKT A++ PA+VHI +QP + Sbjct: 562 KTGSGKTAAFLWPALVHIMDQPEL 585 >SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) Length = 690 Score = 59.7 bits (138), Expect = 2e-09 Identities = 27/56 (48%), Positives = 35/56 (62%) Frame = +2 Query: 332 RSPYEVEEYRNKHEVTVSGVEVHNPIQYFEEXNFPDYVQQGVKTMGYKEPTPIQAQ 499 R +EV+ YR ++TV+G V P+ FEE FPDY+Q K G+ EPT IQAQ Sbjct: 57 RGQHEVDAYRRSKDLTVNGRNVPKPVTTFEESAFPDYIQSYFKREGFTEPTMIQAQ 112 >SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 592 Score = 51.2 bits (117), Expect = 8e-07 Identities = 27/83 (32%), Positives = 43/83 (51%), Gaps = 1/83 (1%) Frame = +2 Query: 263 DWDSVSLQPFXKNFYDPHPTVLKRSPYEVEEYR-NKHEVTVSGVEVHNPIQYFEEXNFPD 439 D +V QPF K+FY P + K +P E +E+R + + V G P++ + + Sbjct: 55 DHKTVVYQPFRKDFYVEVPELAKMTPEETDEFRLSLENIHVRGKNAPKPVKTWAQTGVQL 114 Query: 440 YVQQGVKTMGYKEPTPIQAQGWP 508 + +K Y++PTPIQAQ P Sbjct: 115 KILDVLKKNSYEKPTPIQAQAIP 137 >SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) Length = 500 Score = 50.8 bits (116), Expect = 1e-06 Identities = 23/68 (33%), Positives = 37/68 (54%) Frame = +2 Query: 305 YDPHPTVLKRSPYEVEEYRNKHEVTVSGVEVHNPIQYFEEXNFPDYVQQGVKTMGYKEPT 484 Y HPT+ + +V++ R+K E+ V G V +P+ F +F + + + + GY PT Sbjct: 161 YKEHPTIAALTAEQVKQLRDKMEIKVKGEHVVSPVLEFFHCSFNESLSKNLSNHGYHSPT 220 Query: 485 PIQAQGWP 508 PIQ Q P Sbjct: 221 PIQMQVLP 228 >SB_46680| Best HMM Match : Helicase_C (HMM E-Value=3.8e-22) Length = 1058 Score = 47.2 bits (107), Expect = 1e-05 Identities = 21/59 (35%), Positives = 33/59 (55%), Gaps = 4/59 (6%) Frame = +2 Query: 344 EVEEYRNKHEVTVSGVEVHNPIQYF----EEXNFPDYVQQGVKTMGYKEPTPIQAQGWP 508 ++ +R++ + V G +V +P++ F E FPDY+ V+ GY PTPIQ Q P Sbjct: 137 KINLFRHEQHIYVKGADVPDPVETFSQLIERYGFPDYIIHNVQERGYTTPTPIQMQATP 195 >SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) Length = 428 Score = 43.2 bits (97), Expect = 2e-04 Identities = 18/51 (35%), Positives = 29/51 (56%) Frame = +2 Query: 356 YRNKHEVTVSGVEVHNPIQYFEEXNFPDYVQQGVKTMGYKEPTPIQAQGWP 508 +R ++ G + PI+ ++E PD + + V +GYK+PTPIQ Q P Sbjct: 83 FREDFNISTKGGRIPFPIRKWKEAQIPDSILEIVDKLGYKDPTPIQRQAIP 133 Score = 28.3 bits (60), Expect = 6.2 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +3 Query: 543 QTGSGKTLAYILPAIVHINNQPPI 614 +TGSGKT A+ +P +V I P I Sbjct: 146 ETGSGKTAAFAIPLLVWIMGLPKI 169 >SB_43842| Best HMM Match : RNB (HMM E-Value=0) Length = 1238 Score = 43.2 bits (97), Expect = 2e-04 Identities = 21/70 (30%), Positives = 36/70 (51%) Frame = +2 Query: 290 FXKNFYDPHPTVLKRSPYEVEEYRNKHEVTVSGVEVHNPIQYFEEXNFPDYVQQGVKTMG 469 F ++YD + V + S V+E R K+ + + G + PI+ F + N P + + Sbjct: 32 FMWSYYDENEKVSRLSDEVVDEIRWKNGIHIEGEDCPKPIESFHDLNLPPELSTYLAKKN 91 Query: 470 YKEPTPIQAQ 499 ++ PTPIQ Q Sbjct: 92 FQVPTPIQMQ 101 Score = 32.3 bits (70), Expect = 0.38 Identities = 18/50 (36%), Positives = 26/50 (52%) Frame = +3 Query: 543 QTGSGKTLAYILPAIVHINNQPPISERVMXPIALVXGAXQRVSTNKFQQV 692 +TGSGKTLAY LP + + + P S P+AL+ + + F V Sbjct: 117 ETGSGKTLAYSLPLCMLLRTKAP-SNPGDTPVALILTPTRELMQQVFMNV 165 >SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 33.9 bits (74), Expect = 0.13 Identities = 20/53 (37%), Positives = 27/53 (50%) Frame = +2 Query: 350 EEYRNKHEVTVSGVEVHNPIQYFEEXNFPDYVQQGVKTMGYKEPTPIQAQGWP 508 E+Y ++ EV VSG I FEE N + V+ YK+PTP+Q P Sbjct: 692 EKY-DQIEVLVSGNNPVRHINSFEEANLYEAFLNNVRKAQYKKPTPVQKYSIP 743 Score = 28.3 bits (60), Expect = 6.2 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +3 Query: 543 QTGSGKTLAYILPAIVHINN 602 QTGSGKT A++LP + + N Sbjct: 756 QTGSGKTAAFLLPVMTSMMN 775 >SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) Length = 185 Score = 33.9 bits (74), Expect = 0.13 Identities = 20/53 (37%), Positives = 27/53 (50%) Frame = +2 Query: 350 EEYRNKHEVTVSGVEVHNPIQYFEEXNFPDYVQQGVKTMGYKEPTPIQAQGWP 508 E+Y ++ EV VSG I FEE N + V+ YK+PTP+Q P Sbjct: 115 EKY-DQIEVLVSGNNPVRHINSFEEANLYEAFLNNVRKAQYKKPTPVQKYSIP 166 >SB_49218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 480 Score = 31.1 bits (67), Expect = 0.89 Identities = 11/38 (28%), Positives = 17/38 (44%) Frame = +2 Query: 392 EVHNPIQYFEEXNFPDYVQQGVKTMGYKEPTPIQAQGW 505 ++H P++ + FP Y + Y P P QA W Sbjct: 6 DIHGPVRKLHKHGFPGYEEDYAAVFKYPTPWPEQAMEW 43 >SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 797 Score = 30.3 bits (65), Expect = 1.5 Identities = 14/43 (32%), Positives = 19/43 (44%) Frame = +2 Query: 380 VSGVEVHNPIQYFEEXNFPDYVQQGVKTMGYKEPTPIQAQGWP 508 VSG I F E F + + + GY+ PTP+Q P Sbjct: 469 VSGENQPPKITSFNELPFGEQLMANISRAGYRRPTPVQKAALP 511 Score = 29.5 bits (63), Expect = 2.7 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +3 Query: 543 QTGSGKTLAYILPAIVHINNQ 605 QTGSGKT AY+LP + + Q Sbjct: 524 QTGSGKTAAYMLPVLTSLIKQ 544 >SB_52637| Best HMM Match : Cpn60_TCP1 (HMM E-Value=0) Length = 505 Score = 30.3 bits (65), Expect = 1.5 Identities = 14/44 (31%), Positives = 26/44 (59%) Frame = +2 Query: 338 PYEVEEYRNKHEVTVSGVEVHNPIQYFEEXNFPDYVQQGVKTMG 469 P+E + + KH++ V+ VE + +Q +E F + ++Q VK G Sbjct: 252 PFEPPKPKTKHKLDVATVEDYKKLQEYEREKFTEMIKQ-VKDTG 294 >SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) Length = 490 Score = 29.9 bits (64), Expect = 2.0 Identities = 17/51 (33%), Positives = 27/51 (52%), Gaps = 3/51 (5%) Frame = +2 Query: 365 KHEVTVSGVEVHNPI---QYFEEXNFPDYVQQGVKTMGYKEPTPIQAQGWP 508 KHEV V + +P+ + FEE +++GV MG+ +P+ IQ P Sbjct: 85 KHEVEVLRSDPSSPLYSAKSFEELPLSANLRRGVYDMGFNKPSKIQETALP 135 >SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) Length = 978 Score = 29.1 bits (62), Expect = 3.6 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = +3 Query: 543 QTGSGKTLAYILPAIVH 593 QTGSGKTLAY+ P +VH Sbjct: 423 QTGSGKTLAYLAP-LVH 438 >SB_3046| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 734 Score = 29.1 bits (62), Expect = 3.6 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = -3 Query: 222 HQSLQILQIYCHRCQTETNYRRICCLLQIWNHRFHGY 112 H L YC RC T CCLLQ++++ ++G+ Sbjct: 484 HLQQPSLAAYC-RCITILTTAIACCLLQVYHNTYNGH 519 >SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 697 Score = 29.1 bits (62), Expect = 3.6 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +3 Query: 543 QTGSGKTLAYILPAIVHI 596 +TGSGKTLA+ +P I HI Sbjct: 176 ETGSGKTLAFGIPIIQHI 193 >SB_6554| Best HMM Match : Isy1 (HMM E-Value=0) Length = 675 Score = 29.1 bits (62), Expect = 3.6 Identities = 13/32 (40%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = +2 Query: 350 EEYRNK-HEVTVSGVEVHNPIQYFEEXNFPDY 442 EE NK H++ + + +HNP YFE+ + DY Sbjct: 234 EEVNNKLHKILIVNM-IHNPFNYFEKKSPTDY 264 >SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1375 Score = 28.3 bits (60), Expect = 6.2 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +2 Query: 407 IQYFEEXNFPDYVQQGVKTMGYKEPTPIQAQGWP 508 I FE+ + + + V GYK+PTP+Q P Sbjct: 874 ILQFEDVDLGEILLHNVGLAGYKKPTPVQKYAIP 907 Score = 27.9 bits (59), Expect = 8.3 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +3 Query: 543 QTGSGKTLAYILPAIVHINNQPP 611 QTGSGKT A+++P + I + P Sbjct: 920 QTGSGKTAAFLIPILSRIYMEGP 942 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,151,708 Number of Sequences: 59808 Number of extensions: 344160 Number of successful extensions: 897 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 834 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 896 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1805522550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -