BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060755.seq (692 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein ... 31 0.034 AY534996-1|AAT07394.1| 471|Anopheles gambiae XK-related b protein. 25 2.3 AF387862-1|AAL56547.1| 476|Anopheles gambiae gag polyprotein pr... 24 4.0 AY873992-1|AAW71999.1| 259|Anopheles gambiae nanos protein. 24 5.2 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 23 6.9 >AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein protein. Length = 596 Score = 31.1 bits (67), Expect = 0.034 Identities = 15/46 (32%), Positives = 22/46 (47%) Frame = +2 Query: 371 EVTVSGVEVHNPIQYFEEXNFPDYVQQGVKTMGYKEPTPIQAQGWP 508 +V VSG + ++ FE + V V+ Y +PTPIQ P Sbjct: 161 QVRVSGENPPDHVESFERSGLREEVMTNVRKSSYTKPTPIQRYAIP 206 Score = 30.3 bits (65), Expect = 0.060 Identities = 14/36 (38%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = +3 Query: 543 QTGSGKTLAYILPAIVH-INNQPPISERVMXPIALV 647 QTGSGKT A++LP I H ++ + + R P ++ Sbjct: 219 QTGSGKTAAFMLPMIHHLLDKEDSLELRTRNPYIVI 254 >AY534996-1|AAT07394.1| 471|Anopheles gambiae XK-related b protein. Length = 471 Score = 25.0 bits (52), Expect = 2.3 Identities = 14/47 (29%), Positives = 22/47 (46%) Frame = -1 Query: 173 RRIIAEFVASSKFGTTVSTAIIPVTRHDYFSDLVEDVYLNYGFFLTQ 33 RR+ A+ A ++F ++ YF D+V DV L Y + Q Sbjct: 59 RRVRAKSKAMTEFLPLCDVLFNVISLAGYFCDVVFDVVLGYALYERQ 105 >AF387862-1|AAL56547.1| 476|Anopheles gambiae gag polyprotein protein. Length = 476 Score = 24.2 bits (50), Expect = 4.0 Identities = 15/38 (39%), Positives = 20/38 (52%), Gaps = 6/38 (15%) Frame = -3 Query: 246 ALQRXLFSHQSLQILQ------IYCHRCQTETNYRRIC 151 A +R SHQS IL+ I CHRC+ + +R C Sbjct: 180 AQKRMEKSHQSESILRVGPEKKITCHRCRKPGHMKRDC 217 >AY873992-1|AAW71999.1| 259|Anopheles gambiae nanos protein. Length = 259 Score = 23.8 bits (49), Expect = 5.2 Identities = 10/36 (27%), Positives = 22/36 (61%) Frame = +2 Query: 245 AEHGRPDWDSVSLQPFXKNFYDPHPTVLKRSPYEVE 352 A +G + + + + F KN+ D P ++ +SPY+++ Sbjct: 23 APYGWNEQMNEAAREFLKNYPDFIPMLIGQSPYKID 58 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 23.4 bits (48), Expect = 6.9 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +2 Query: 323 VLKRSPYEVEEYRNKHEVTVSGVEVHNPIQY 415 V++R P V+ + H+V V VH P+ + Sbjct: 139 VVRREPSAVKIAQPVHKVIAQPVHVHAPVAH 169 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 618,165 Number of Sequences: 2352 Number of extensions: 11293 Number of successful extensions: 16 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 70250040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -