BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060754.seq (683 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.50 SB_16217| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.50 SB_7913| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.66 SB_12670| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_9594| Best HMM Match : Extensin_2 (HMM E-Value=0.066) 31 1.1 SB_32583| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_11571| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_51714| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_30707| Best HMM Match : ARID (HMM E-Value=4e-35) 29 2.7 SB_7678| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_48221| Best HMM Match : Caudal_act (HMM E-Value=5) 29 2.7 SB_10763| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_3703| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_48885| Best HMM Match : DUF741 (HMM E-Value=0.88) 29 3.5 SB_31792| Best HMM Match : DUF1373 (HMM E-Value=2.5) 29 3.5 SB_23960| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_59679| Best HMM Match : Lectin_C (HMM E-Value=5.3e-10) 28 6.1 SB_55679| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 SB_45391| Best HMM Match : DUF1509 (HMM E-Value=1.9) 28 6.1 SB_18330| Best HMM Match : rve (HMM E-Value=1.2e-16) 28 6.1 SB_15142| Best HMM Match : rve (HMM E-Value=1.1e-13) 28 6.1 SB_6077| Best HMM Match : EGF (HMM E-Value=0) 28 6.1 SB_52266| Best HMM Match : DUF1665 (HMM E-Value=1.3) 28 8.1 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_23956| Best HMM Match : AT_hook (HMM E-Value=3.7) 28 8.1 SB_58599| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_57323| Best HMM Match : ShTK (HMM E-Value=0) 28 8.1 SB_32762| Best HMM Match : Extensin_2 (HMM E-Value=0.062) 28 8.1 SB_18606| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_8748| Best HMM Match : Astacin (HMM E-Value=0) 28 8.1 >SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1572 Score = 31.9 bits (69), Expect = 0.50 Identities = 19/49 (38%), Positives = 21/49 (42%), Gaps = 2/49 (4%) Frame = +1 Query: 397 ALHPRENPAGTSSRRHTVSGAQEP--PCAASPPDQQPSTVTPHPAPDSP 537 A HPR P G S R GA P P +P + P TPHP P Sbjct: 546 APHPRVPPPGASHPRVPPPGAPHPRVPPPGAPHPRVPPPGTPHPRVPPP 594 Score = 31.1 bits (67), Expect = 0.87 Identities = 20/55 (36%), Positives = 25/55 (45%), Gaps = 5/55 (9%) Frame = +1 Query: 397 ALHPRENPAGTSSRRHTVSGAQEP--PCAASPPDQQPSTVTPH---PAPDSPYGR 546 A HPR P G S +R GA P P +P + P PH P P +P+ R Sbjct: 406 APHPRVPPPGASHQRVRPPGAPHPRVPPPGAPHPRFPPPGAPHPRVPPPGAPHPR 460 Score = 29.5 bits (63), Expect = 2.7 Identities = 19/55 (34%), Positives = 24/55 (43%), Gaps = 5/55 (9%) Frame = +1 Query: 397 ALHPRENPAGTSSRRHTVSGAQEP--PCAASPPDQQPSTVTPH---PAPDSPYGR 546 A HPR P G +R GA P P +P + P PH P P +P+ R Sbjct: 486 APHPRVPPPGAPHQRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPR 540 Score = 27.9 bits (59), Expect = 8.1 Identities = 20/55 (36%), Positives = 23/55 (41%), Gaps = 5/55 (9%) Frame = +1 Query: 397 ALHPRENPAGTSSRRHTVSGAQEP--PCAASPPDQQPSTVTPH---PAPDSPYGR 546 A HPR P GT R GA P P +P + P + H P P PY R Sbjct: 576 APHPRVPPPGTPHPRVPPPGAPHPKVPPPGAPYQRLPYSGAYHPRLPPPGPPYQR 630 >SB_16217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 587 Score = 31.9 bits (69), Expect = 0.50 Identities = 14/42 (33%), Positives = 24/42 (57%) Frame = +1 Query: 406 PRENPAGTSSRRHTVSGAQEPPCAASPPDQQPSTVTPHPAPD 531 PR+ PA + TV + PP ++S P Q+P++ T P+ + Sbjct: 185 PRQAPAAKTHSSSTVPRSGSPPVSSSRPAQKPTSQTALPSTE 226 >SB_7913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 336 Score = 31.5 bits (68), Expect = 0.66 Identities = 17/39 (43%), Positives = 21/39 (53%), Gaps = 3/39 (7%) Frame = +2 Query: 419 PQERRLGDTP*AVHRSHLAPPHHRTN---SRVXSPRTRH 526 P+ RR +P RS PHHR++ SR SPR RH Sbjct: 231 PRRRRRSRSPRRRRRSRSPSPHHRSHRSRSRSRSPRRRH 269 >SB_12670| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1272 Score = 31.1 bits (67), Expect = 0.87 Identities = 24/89 (26%), Positives = 36/89 (40%), Gaps = 2/89 (2%) Frame = +2 Query: 257 RRANTCPAERLPTKPYQAPPLRLHETHGTAQCAPKSPSPVPILLIGRHSIPGKIPQERRL 436 R+ P R P P R +++ ++ SP+P P R S P+ RR Sbjct: 877 RKRYDSPPRRRRRSPSPPPRRRRRDSYSPSRRRRDSPTPSPPPRRRRKSPSPSPPRRRRR 936 Query: 437 --GDTP*AVHRSHLAPPHHRTNSRVXSPR 517 ++P + S L PP + S SPR Sbjct: 937 SPSNSPPPMRSSPLPPPQRKRASTPPSPR 965 >SB_9594| Best HMM Match : Extensin_2 (HMM E-Value=0.066) Length = 361 Score = 30.7 bits (66), Expect = 1.1 Identities = 20/63 (31%), Positives = 28/63 (44%), Gaps = 7/63 (11%) Frame = +1 Query: 367 VAGTHPVNR--TALHPRENPAGTSSRRHT----VSGAQEPPCAASPPDQQPSTVTP-HPA 525 + HP + TA+HP +P T H+ V PP A P P+TV P H Sbjct: 98 LTAVHPCHSPPTAVHPCHSPPNTVRPCHSPPTAVRPCHSPPTAVRPCHSPPNTVRPCHSP 157 Query: 526 PDS 534 P++ Sbjct: 158 PNT 160 Score = 29.5 bits (63), Expect = 2.7 Identities = 17/49 (34%), Positives = 22/49 (44%), Gaps = 4/49 (8%) Frame = +1 Query: 394 TALHPRENPAGTSSRRHT----VSGAQEPPCAASPPDQQPSTVTPHPAP 528 TA+HP +P T H+ V PP A P P+TV P +P Sbjct: 79 TAVHPCHSPPNTVRPCHSPLTAVHPCHSPPTAVHPCHSPPNTVRPCHSP 127 >SB_32583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 526 Score = 30.3 bits (65), Expect = 1.5 Identities = 21/64 (32%), Positives = 26/64 (40%) Frame = +2 Query: 290 PTKPYQAPPLRLHETHGTAQCAPKSPSPVPILLIGRHSIPGKIPQERRLGDTP*AVHRSH 469 PT Y P LH H A SP P P ++I H + P P ++HR H Sbjct: 22 PTPCYGITPHPLHRHH-LPPPATASP-PTPCIVIISHPLHRHHPPPPASSSFPHSLHRHH 79 Query: 470 LAPP 481 PP Sbjct: 80 PPPP 83 >SB_11571| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 469 Score = 30.3 bits (65), Expect = 1.5 Identities = 17/60 (28%), Positives = 26/60 (43%) Frame = +1 Query: 349 VRAEVAVAGTHPVNRTALHPRENPAGTSSRRHTVSGAQEPPCAASPPDQQPSTVTPHPAP 528 V A + + + P N AL P + P+ T + T P +PP +Q + PH P Sbjct: 39 VSASASSSTSRPTN--ALQPLKPPSNTPQQLTTPPHQSNTPRPLTPPSRQSNNPRPHTPP 96 >SB_51714| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 542 Score = 29.5 bits (63), Expect = 2.7 Identities = 13/36 (36%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = +1 Query: 430 SSRRHTVSGAQEPPCA-ASPPDQQPSTVTPHPAPDS 534 ++RR+ +Q+P SPP +QP+T P P P++ Sbjct: 476 NTRRNPPPPSQDPTTGNPSPPQEQPTTGNPTPPPNN 511 >SB_30707| Best HMM Match : ARID (HMM E-Value=4e-35) Length = 1338 Score = 29.5 bits (63), Expect = 2.7 Identities = 20/60 (33%), Positives = 27/60 (45%), Gaps = 5/60 (8%) Frame = +1 Query: 370 AGTHPVNRTALHPRENPAGTSSRRHTVSGAQEPPCAASP-----PDQQPSTVTPHPAPDS 534 AG ++ L R +P G SR T S A A +P P+ +PST P P+S Sbjct: 329 AGPKKPDKLILPDRSSPTGKPSRVPTPSKATPSKRATTPNNKGKPNSKPSTPNQPPTPES 388 >SB_7678| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1432 Score = 29.5 bits (63), Expect = 2.7 Identities = 18/58 (31%), Positives = 28/58 (48%), Gaps = 2/58 (3%) Frame = +3 Query: 420 RRNVVSETHRERCTGATLRRLTTGPTAEYXHPA-PGTRQPLR-EMNGSFAPVPPTSAF 587 + + VS + R T PT+ Y P PG+ + + EMN F+ +PP S+F Sbjct: 373 KNSYVSTVMQRRDMDITKTNFHQHPTSVYQEPVYPGSSRTVPLEMNKCFSSLPPVSSF 430 >SB_48221| Best HMM Match : Caudal_act (HMM E-Value=5) Length = 317 Score = 29.5 bits (63), Expect = 2.7 Identities = 18/58 (31%), Positives = 28/58 (48%), Gaps = 2/58 (3%) Frame = +3 Query: 420 RRNVVSETHRERCTGATLRRLTTGPTAEYXHPA-PGTRQPLR-EMNGSFAPVPPTSAF 587 + + VS + R T PT+ Y P PG+ + + EMN F+ +PP S+F Sbjct: 87 KNSYVSTVMQRRDMDITKTNFHQHPTSVYQEPVYPGSSRTVPLEMNKCFSSLPPVSSF 144 >SB_10763| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 260 Score = 29.5 bits (63), Expect = 2.7 Identities = 21/69 (30%), Positives = 31/69 (44%), Gaps = 9/69 (13%) Frame = +1 Query: 355 AEVAVAGTHPVNRT---ALHPRENPAGTSSRRHTVSGAQE------PPCAASPPDQQPST 507 AE A G+ P +T A P A T++ + + A++ P A+SP QP+ Sbjct: 77 AEAAAVGSSPAAKTPSSASSPSSATAATTAGKPVAAAAKDLPEVRKPATASSPAPSQPAA 136 Query: 508 VTPHPAPDS 534 TP A S Sbjct: 137 ATPSDAAAS 145 >SB_3703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 930 Score = 29.5 bits (63), Expect = 2.7 Identities = 18/58 (31%), Positives = 28/58 (48%), Gaps = 2/58 (3%) Frame = +3 Query: 420 RRNVVSETHRERCTGATLRRLTTGPTAEYXHPA-PGTRQPLR-EMNGSFAPVPPTSAF 587 + + VS + R T PT+ Y P PG+ + + EMN F+ +PP S+F Sbjct: 768 KNSYVSTVMQRRDMDITKTNFHQHPTSVYQEPVYPGSSRTVPLEMNKCFSSLPPVSSF 825 >SB_48885| Best HMM Match : DUF741 (HMM E-Value=0.88) Length = 841 Score = 29.1 bits (62), Expect = 3.5 Identities = 16/40 (40%), Positives = 20/40 (50%), Gaps = 3/40 (7%) Frame = +1 Query: 433 SRRHTVSGAQEPPCAASPPDQQPST---VTPHPAPDSPYG 543 S+ VSG+Q PP +S P PS V+P AP G Sbjct: 584 SQAPAVSGSQSPPLTSSTPPMNPSNPIHVSPVAAPPGSSG 623 >SB_31792| Best HMM Match : DUF1373 (HMM E-Value=2.5) Length = 696 Score = 29.1 bits (62), Expect = 3.5 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = +1 Query: 424 GTSSRRHTVSGAQEPPCAASPPDQQPSTVTPHPAP 528 G SS H++ G +P A QQP T P P P Sbjct: 411 GDSSLLHSLLGQPDPLSWAQQELQQPQTAQPQPLP 445 Score = 27.9 bits (59), Expect = 8.1 Identities = 27/90 (30%), Positives = 36/90 (40%), Gaps = 1/90 (1%) Frame = +2 Query: 266 NTCPAERLPTKPYQAPPLRLHETHGTAQCAPKSPSPVPILLIGRHSIP-GKIPQERRLGD 442 +T P+ L + P ++ + +P SPSPV + RHSIP G P Sbjct: 447 DTLPSSSLFSSPADPLTALGYQDQISQALSPVSPSPVVVPGQARHSIPLGPQPAYGGSDL 506 Query: 443 TP*AVHRSHLAPPHHRTNSRVXSPRTRHPT 532 P RSH H R + R R PT Sbjct: 507 LPYEDRRSHYL-RHRRPHRRRFRYRPDTPT 535 >SB_23960| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 29.1 bits (62), Expect = 3.5 Identities = 23/79 (29%), Positives = 36/79 (45%), Gaps = 5/79 (6%) Frame = +2 Query: 251 LKRRANTCPAERLPTKPYQAPPLRLHETHGTAQ---CAPKSPSP--VPILLIGRHSIPGK 415 +K R C +L K A LR H Q C+ + S +P++ +G H I Sbjct: 3 VKPRVFQCYRAQLSMKDISAISLRQHYQRKLPQLPECSARKRSTRCMPVVELGFHGIILG 62 Query: 416 IPQERRLGDTP*AVHRSHL 472 +P+ + L DTP + SH+ Sbjct: 63 LPKRQTLQDTPGNLCDSHV 81 >SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1870 Score = 28.7 bits (61), Expect = 4.6 Identities = 18/50 (36%), Positives = 23/50 (46%), Gaps = 3/50 (6%) Frame = +1 Query: 397 ALHPRENPAGTSSR---RHTVSGAQEPPCAASPPDQQPSTVTPHPAPDSP 537 A + R NP S R + G P PP + P TVTP P+ D+P Sbjct: 1625 ARYVRINPTSWESSICLRAEIYGCPVTPPTTDPP-RPPVTVTPKPSTDAP 1673 Score = 27.9 bits (59), Expect = 8.1 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = +1 Query: 466 PPCAASPPDQQPSTVTPHPAPDSP 537 PP PP +P TP P P +P Sbjct: 1362 PPTPPRPPTPRPRPPTPRPGPPTP 1385 >SB_59679| Best HMM Match : Lectin_C (HMM E-Value=5.3e-10) Length = 849 Score = 28.3 bits (60), Expect = 6.1 Identities = 13/38 (34%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = +2 Query: 263 ANTCPAERLPTKPYQAPPLRLHET-HGTAQCAPKSPSP 373 A+TC PT +Q P + +G + CAP +P P Sbjct: 285 ASTCTTACSPTCCFQTPSYTPYSACYGASPCAPPTPKP 322 >SB_55679| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 203 Score = 28.3 bits (60), Expect = 6.1 Identities = 13/46 (28%), Positives = 19/46 (41%) Frame = +1 Query: 403 HPRENPAGTSSRRHTVSGAQEPPCAASPPDQQPSTVTPHPAPDSPY 540 HP +P S+ + + EPP S P Q + P +PY Sbjct: 24 HPLLHPVHLSTTLYYIQSISEPPLTTSSPSQYHPLLHPVHLSTTPY 69 >SB_45391| Best HMM Match : DUF1509 (HMM E-Value=1.9) Length = 402 Score = 28.3 bits (60), Expect = 6.1 Identities = 15/56 (26%), Positives = 20/56 (35%) Frame = +1 Query: 379 HPVNRTALHPRENPAGTSSRRHTVSGAQEPPCAASPPDQQPSTVTPHPAPDSPYGR 546 +P + T + P +SG + P P P P P SPYGR Sbjct: 205 YPYSNTVARSQNRPGAPPLLNSLLSGNRPTPQTEDNPGPPPVYPPNPPEPYSPYGR 260 >SB_18330| Best HMM Match : rve (HMM E-Value=1.2e-16) Length = 997 Score = 28.3 bits (60), Expect = 6.1 Identities = 18/43 (41%), Positives = 20/43 (46%), Gaps = 1/43 (2%) Frame = +1 Query: 412 ENPAGTSSRR-HTVSGAQEPPCAASPPDQQPSTVTPHPAPDSP 537 E GT+ RR H Q+ P SP DQ P V P PD P Sbjct: 915 ETDDGTTLRRNHADIWMQQTP---SPEDQSPVPVATVPGPDPP 954 >SB_15142| Best HMM Match : rve (HMM E-Value=1.1e-13) Length = 442 Score = 28.3 bits (60), Expect = 6.1 Identities = 13/26 (50%), Positives = 17/26 (65%), Gaps = 2/26 (7%) Frame = +1 Query: 421 AGTSSRRHTVSGAQE--PPCAASPPD 492 A +SR + S +E PPC+ASPPD Sbjct: 104 ADATSRHPSQSNTEEKAPPCSASPPD 129 >SB_6077| Best HMM Match : EGF (HMM E-Value=0) Length = 1165 Score = 28.3 bits (60), Expect = 6.1 Identities = 19/50 (38%), Positives = 20/50 (40%) Frame = -1 Query: 542 P*GLSGAGCGVTVLGCWSGGEAAQGGSCAPLTVCLRDDVPAGFSRGWSAV 393 P G +G C V V C A G SC L R PAGF AV Sbjct: 584 PRGFTGTLCDVNVDEC-EDSPCANGASCEDLINDFRCHCPAGFQGRTCAV 632 >SB_52266| Best HMM Match : DUF1665 (HMM E-Value=1.3) Length = 697 Score = 27.9 bits (59), Expect = 8.1 Identities = 19/51 (37%), Positives = 25/51 (49%), Gaps = 3/51 (5%) Frame = +1 Query: 382 PVNR--TALHPREN-PAGTSSRRHTVSGAQEPPCAASPPDQQPSTVTPHPA 525 P NR +A +EN P G + +R VS P A PP P+ P+PA Sbjct: 251 PSNRPVSAYEQKENIPVGENKQR-PVSANNAPTPAWQPPRPMPAWAPPNPA 300 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 27.9 bits (59), Expect = 8.1 Identities = 12/48 (25%), Positives = 21/48 (43%) Frame = +1 Query: 379 HPVNRTALHPRENPAGTSSRRHTVSGAQEPPCAASPPDQQPSTVTPHP 522 HP + + P NP+ S + + + +P + SP +V P P Sbjct: 550 HPSSNPSSEPSPNPSSNPSSDPSPNPSSDPSLSFSPSSSSSPSVRPSP 597 >SB_23956| Best HMM Match : AT_hook (HMM E-Value=3.7) Length = 240 Score = 27.9 bits (59), Expect = 8.1 Identities = 15/55 (27%), Positives = 21/55 (38%) Frame = +1 Query: 373 GTHPVNRTALHPRENPAGTSSRRHTVSGAQEPPCAASPPDQQPSTVTPHPAPDSP 537 G+HPV T + PA + + A P ++ PD P P P P Sbjct: 158 GSHPVIPTECNQTVPPAEPVAETPPTTQANNDPVSSCMPDASSQAPQPLPEPKRP 212 >SB_58599| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 616 Score = 27.9 bits (59), Expect = 8.1 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +1 Query: 466 PPCAASPPDQQPSTVTPHPAPDSP 537 PP A +PP PS TP P PD P Sbjct: 412 PPSARTPPVCPPSASTP-PVPDVP 434 >SB_57323| Best HMM Match : ShTK (HMM E-Value=0) Length = 911 Score = 27.9 bits (59), Expect = 8.1 Identities = 15/41 (36%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +1 Query: 418 PAGTSSRRHTVSGAQEPPCAASPPDQQPSTVTP-HPAPDSP 537 P T S V +P C PD QP T P PD+P Sbjct: 678 PQTTVSPGTPVPPTDDPDCTTETPDTQPPTQPPVTQPPDTP 718 >SB_32762| Best HMM Match : Extensin_2 (HMM E-Value=0.062) Length = 830 Score = 27.9 bits (59), Expect = 8.1 Identities = 16/51 (31%), Positives = 23/51 (45%) Frame = +1 Query: 388 NRTALHPRENPAGTSSRRHTVSGAQEPPCAASPPDQQPSTVTPHPAPDSPY 540 NRT + P + T + + P A SPP+ PS P+ AP P+ Sbjct: 279 NRTEIPPLSSLIATHNHSPPNTAPSPPNIAPSPPNIAPS--PPNTAPSPPH 327 >SB_18606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1401 Score = 27.9 bits (59), Expect = 8.1 Identities = 15/49 (30%), Positives = 21/49 (42%) Frame = +2 Query: 233 LTGDYDLKRRANTCPAERLPTKPYQAPPLRLHETHGTAQCAPKSPSPVP 379 L G +RANT E + ++H GT P+ P+PVP Sbjct: 930 LEGVLSATQRANTSQVEGAVRSRTSSRRSQVHSLDGTLATIPELPTPVP 978 >SB_8748| Best HMM Match : Astacin (HMM E-Value=0) Length = 757 Score = 27.9 bits (59), Expect = 8.1 Identities = 26/97 (26%), Positives = 35/97 (36%), Gaps = 2/97 (2%) Frame = +1 Query: 370 AGTHPVNRTALHPRENPAGTSSRRHTVSGAQEPPCAASPPDQQPST--VTPHPAPDSPYG 543 A T+P TA AGTS +V A P + +PP P++ TP P S Sbjct: 531 ASTNPTPTTA-----ETAGTSGAPTSVPPASSAPASGAPPSGAPASGATTPTTGPISGAP 585 Query: 544 R*TGAXXXXXXXXXXXXXXXXGDPTSLSRSFSLXETP 654 G +PT+ S + S TP Sbjct: 586 ASNGPTSGSTGANQPTSGSTSANPTTSSATGSQPSTP 622 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,640,562 Number of Sequences: 59808 Number of extensions: 497305 Number of successful extensions: 2186 Number of sequences better than 10.0: 31 Number of HSP's better than 10.0 without gapping: 1702 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2134 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1769412099 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -