BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060753.seq (666 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_25136| Best HMM Match : Thiolase_N (HMM E-Value=4.4e-09) 91 7e-19 SB_39828| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 1e-07 SB_58422| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_57564| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_57282| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_55675| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_53531| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_51851| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_51844| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_51267| Best HMM Match : Thiolase_N (HMM E-Value=2.2e-35) 52 4e-07 SB_49026| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_47126| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_42980| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_41200| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_39911| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_38934| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_37980| Best HMM Match : 7tm_2 (HMM E-Value=5.3e-13) 52 4e-07 SB_34283| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_29488| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_28464| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_23522| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_19655| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_18351| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_17016| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_15018| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_13950| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_12937| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_12563| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_9931| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_5449| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_59704| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) 52 4e-07 SB_58431| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_54126| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_45758| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_44961| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_44549| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_36128| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_35247| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_34984| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_34197| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_32036| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_28547| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_26763| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_26757| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_26470| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_24001| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_23476| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_23166| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_19253| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_13603| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_13164| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_11232| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_7675| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_4220| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_1385| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_951| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_23705| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_3186| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_7199| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_30177| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_12473| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_18205| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_14249| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.37 SB_42356| Best HMM Match : PDZ (HMM E-Value=5.7e-19) 31 0.64 SB_5571| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.84 SB_7831| Best HMM Match : RNA_pol_Rpb1_7 (HMM E-Value=0) 31 1.1 SB_48069| Best HMM Match : DUF746 (HMM E-Value=4.5) 30 1.5 SB_30176| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_19024| Best HMM Match : Thiolase_C (HMM E-Value=5.4e-36) 30 1.5 SB_14689| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_1573| Best HMM Match : Thiolase_C (HMM E-Value=1.6e-40) 30 1.5 SB_53740| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0) 30 1.9 SB_24967| Best HMM Match : Drf_FH1 (HMM E-Value=0.65) 29 3.4 SB_50433| Best HMM Match : MFAP1_C (HMM E-Value=0.24) 29 4.5 SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_33735| Best HMM Match : Aminotran_1_2 (HMM E-Value=0.13) 29 4.5 SB_4468| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_45599| Best HMM Match : GRP (HMM E-Value=0.22) 29 4.5 SB_41306| Best HMM Match : Ribosomal_L19e (HMM E-Value=8.5) 29 4.5 SB_31712| Best HMM Match : LIM (HMM E-Value=9e-26) 29 4.5 SB_15482| Best HMM Match : LIM (HMM E-Value=0) 29 4.5 SB_16403| Best HMM Match : Candida_ALS (HMM E-Value=1.7) 28 5.9 SB_12155| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.9 SB_28656| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.9 SB_26630| Best HMM Match : ig (HMM E-Value=0.0021) 28 5.9 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 SB_12801| Best HMM Match : TSP_3 (HMM E-Value=2.3e-39) 28 7.9 SB_27584| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 28 7.9 SB_8223| Best HMM Match : RVT_1 (HMM E-Value=4e-27) 28 7.9 >SB_25136| Best HMM Match : Thiolase_N (HMM E-Value=4.4e-09) Length = 162 Score = 91.1 bits (216), Expect = 7e-19 Identities = 44/75 (58%), Positives = 54/75 (72%) Frame = +2 Query: 35 ARMTRKIVKRSTFLVDGKDGLVDKDNGIRVSAPEQLAKLKPAFIKPHGTVTAANASFLTD 214 A K+ ++ V G ++ DNGIRVS P+Q+AKLKPAFI+P GT+TAAN+SFLTD Sbjct: 45 ATQAGKLTDVLSYQVPGTTTVLSADNGIRVSTPQQMAKLKPAFIRPFGTITAANSSFLTD 104 Query: 215 GASACLXMSEAKARS 259 GASACL M E KA S Sbjct: 105 GASACLVMCEEKALS 119 Score = 50.4 bits (115), Expect = 1e-06 Identities = 29/62 (46%), Positives = 35/62 (56%) Frame = +1 Query: 247 KGQELGLKPKAYLRDFTYVAQDPVDQLLLGPAYGIPKILDKVGLKVNDIDTWEIHEAFAG 426 K +GLKPKAYL PAY PK+L+K GLK++DID +E HEAFA Sbjct: 116 KALSMGLKPKAYL----------------SPAYATPKLLEKTGLKLSDIDVFEFHEAFAV 159 Query: 427 QI 432 I Sbjct: 160 SI 161 >SB_39828| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 53.6 bits (123), Expect = 1e-07 Identities = 24/26 (92%), Positives = 24/26 (92%) Frame = +1 Query: 1 GTIQRRLAWPLRKDDTQNREAFHIFS 78 GTIQRRLAWPLRKDDTQ REAF IFS Sbjct: 14 GTIQRRLAWPLRKDDTQIREAFQIFS 39 Score = 53.6 bits (123), Expect = 1e-07 Identities = 24/26 (92%), Positives = 24/26 (92%) Frame = +1 Query: 1 GTIQRRLAWPLRKDDTQNREAFHIFS 78 GTIQRRLAWPLRKDDTQ REAF IFS Sbjct: 48 GTIQRRLAWPLRKDDTQIREAFQIFS 73 >SB_58422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 52.0 bits (119), Expect = 4e-07 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = +1 Query: 1 GTIQRRLAWPLRKDDTQNREAFHIF 75 GTIQRRLAWPLRKDDTQ REAF IF Sbjct: 14 GTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_57564| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 52.0 bits (119), Expect = 4e-07 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = +1 Query: 1 GTIQRRLAWPLRKDDTQNREAFHIF 75 GTIQRRLAWPLRKDDTQ REAF IF Sbjct: 14 GTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_57282| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 52.0 bits (119), Expect = 4e-07 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = +1 Query: 1 GTIQRRLAWPLRKDDTQNREAFHIF 75 GTIQRRLAWPLRKDDTQ REAF IF Sbjct: 14 GTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_55675| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 52.0 bits (119), Expect = 4e-07 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = +1 Query: 1 GTIQRRLAWPLRKDDTQNREAFHIF 75 GTIQRRLAWPLRKDDTQ REAF IF Sbjct: 14 GTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_53531| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 52.0 bits (119), Expect = 4e-07 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = +1 Query: 1 GTIQRRLAWPLRKDDTQNREAFHIF 75 GTIQRRLAWPLRKDDTQ REAF IF Sbjct: 14 GTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_51851| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 52.0 bits (119), Expect = 4e-07 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = +1 Query: 1 GTIQRRLAWPLRKDDTQNREAFHIF 75 GTIQRRLAWPLRKDDTQ REAF IF Sbjct: 14 GTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_51844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 52.0 bits (119), Expect = 4e-07 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = +1 Query: 1 GTIQRRLAWPLRKDDTQNREAFHIF 75 GTIQRRLAWPLRKDDTQ REAF IF Sbjct: 14 GTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_51267| Best HMM Match : Thiolase_N (HMM E-Value=2.2e-35) Length = 415 Score = 52.0 bits (119), Expect = 4e-07 Identities = 28/71 (39%), Positives = 40/71 (56%) Frame = +1 Query: 241 RGKGQELGLKPKAYLRDFTYVAQDPVDQLLLGPAYGIPKILDKVGLKVNDIDTWEIHEAF 420 R ++ G+ P A + F A P+D + PA IPK+L L+ +DID WEI+EAF Sbjct: 164 REAAEKNGVTPLASIVAFADAAVAPID-FPIAPAAAIPKVLRLAHLRKDDIDMWEINEAF 222 Query: 421 AGQILANLKAL 453 + LAN+ L Sbjct: 223 SAVALANINVL 233 Score = 44.0 bits (99), Expect = 1e-04 Identities = 25/61 (40%), Positives = 36/61 (59%), Gaps = 1/61 (1%) Frame = +2 Query: 83 GKDGLV-DKDNGIRVSAPEQLAKLKPAFIKPHGTVTAANASFLTDGASACLXMSEAKARS 259 GK +V ++D + + E+ LK F K +GTVTAANAS L DGA+A + M+ A Sbjct: 110 GKPDIVFEEDEEYKKVSFEKFPSLKTVFKKENGTVTAANASTLNDGAAAVVLMTREAAEK 169 Query: 260 S 262 + Sbjct: 170 N 170 >SB_49026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 52.0 bits (119), Expect = 4e-07 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = +1 Query: 1 GTIQRRLAWPLRKDDTQNREAFHIF 75 GTIQRRLAWPLRKDDTQ REAF IF Sbjct: 14 GTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_47126| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 52.0 bits (119), Expect = 4e-07 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = +1 Query: 1 GTIQRRLAWPLRKDDTQNREAFHIF 75 GTIQRRLAWPLRKDDTQ REAF IF Sbjct: 14 GTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_42980| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 52.0 bits (119), Expect = 4e-07 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = +1 Query: 1 GTIQRRLAWPLRKDDTQNREAFHIF 75 GTIQRRLAWPLRKDDTQ REAF IF Sbjct: 14 GTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_41200| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 52.0 bits (119), Expect = 4e-07 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = +1 Query: 1 GTIQRRLAWPLRKDDTQNREAFHIF 75 GTIQRRLAWPLRKDDTQ REAF IF Sbjct: 14 GTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_39911| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 52.0 bits (119), Expect = 4e-07 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = +1 Query: 1 GTIQRRLAWPLRKDDTQNREAFHIF 75 GTIQRRLAWPLRKDDTQ REAF IF Sbjct: 14 GTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_38934| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 52.0 bits (119), Expect = 4e-07 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = +1 Query: 1 GTIQRRLAWPLRKDDTQNREAFHIF 75 GTIQRRLAWPLRKDDTQ REAF IF Sbjct: 19 GTIQRRLAWPLRKDDTQIREAFQIF 43 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/26 (84%), Positives = 22/26 (84%) Frame = +1 Query: 1 GTIQRRLAWPLRKDDTQNREAFHIFS 78 GTIQRRLAWPLRKDDTQ REA FS Sbjct: 61 GTIQRRLAWPLRKDDTQIREASKFFS 86 >SB_37980| Best HMM Match : 7tm_2 (HMM E-Value=5.3e-13) Length = 1297 Score = 52.0 bits (119), Expect = 4e-07 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = +1 Query: 1 GTIQRRLAWPLRKDDTQNREAFHIF 75 GTIQRRLAWPLRKDDTQ REAF IF Sbjct: 1061 GTIQRRLAWPLRKDDTQIREAFQIF 1085 >SB_34283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 52.0 bits (119), Expect = 4e-07 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = +1 Query: 1 GTIQRRLAWPLRKDDTQNREAFHIF 75 GTIQRRLAWPLRKDDTQ REAF IF Sbjct: 14 GTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_29488| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 52.0 bits (119), Expect = 4e-07 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = +1 Query: 1 GTIQRRLAWPLRKDDTQNREAFHIF 75 GTIQRRLAWPLRKDDTQ REAF IF Sbjct: 14 GTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_28464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 60 Score = 52.0 bits (119), Expect = 4e-07 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = +1 Query: 1 GTIQRRLAWPLRKDDTQNREAFHIF 75 GTIQRRLAWPLRKDDTQ REAF IF Sbjct: 31 GTIQRRLAWPLRKDDTQIREAFQIF 55 >SB_23522| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 52.0 bits (119), Expect = 4e-07 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = +1 Query: 1 GTIQRRLAWPLRKDDTQNREAFHIF 75 GTIQRRLAWPLRKDDTQ REAF IF Sbjct: 14 GTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_19655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 52.0 bits (119), Expect = 4e-07 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = +1 Query: 1 GTIQRRLAWPLRKDDTQNREAFHIF 75 GTIQRRLAWPLRKDDTQ REAF IF Sbjct: 14 GTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_18351| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 52.0 bits (119), Expect = 4e-07 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = +1 Query: 1 GTIQRRLAWPLRKDDTQNREAFHIF 75 GTIQRRLAWPLRKDDTQ REAF IF Sbjct: 14 GTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_17016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 52.0 bits (119), Expect = 4e-07 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = +1 Query: 1 GTIQRRLAWPLRKDDTQNREAFHIF 75 GTIQRRLAWPLRKDDTQ REAF IF Sbjct: 14 GTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_15018| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 52.0 bits (119), Expect = 4e-07 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = +1 Query: 1 GTIQRRLAWPLRKDDTQNREAFHIF 75 GTIQRRLAWPLRKDDTQ REAF IF Sbjct: 14 GTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_13950| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 52.0 bits (119), Expect = 4e-07 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = +1 Query: 1 GTIQRRLAWPLRKDDTQNREAFHIF 75 GTIQRRLAWPLRKDDTQ REAF IF Sbjct: 14 GTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_12937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 52.0 bits (119), Expect = 4e-07 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = +1 Query: 1 GTIQRRLAWPLRKDDTQNREAFHIF 75 GTIQRRLAWPLRKDDTQ REAF IF Sbjct: 14 GTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_12563| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 52.0 bits (119), Expect = 4e-07 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = +1 Query: 1 GTIQRRLAWPLRKDDTQNREAFHIF 75 GTIQRRLAWPLRKDDTQ REAF IF Sbjct: 14 GTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_9931| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 52.0 bits (119), Expect = 4e-07 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = +1 Query: 1 GTIQRRLAWPLRKDDTQNREAFHIF 75 GTIQRRLAWPLRKDDTQ REAF IF Sbjct: 14 GTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_5449| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 52.0 bits (119), Expect = 4e-07 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = +1 Query: 1 GTIQRRLAWPLRKDDTQNREAFHIF 75 GTIQRRLAWPLRKDDTQ REAF IF Sbjct: 14 GTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_59704| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 52.0 bits (119), Expect = 4e-07 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = +1 Query: 1 GTIQRRLAWPLRKDDTQNREAFHIF 75 GTIQRRLAWPLRKDDTQ REAF IF Sbjct: 14 GTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) Length = 154 Score = 52.0 bits (119), Expect = 4e-07 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = +1 Query: 1 GTIQRRLAWPLRKDDTQNREAFHIF 75 GTIQRRLAWPLRKDDTQ REAF IF Sbjct: 126 GTIQRRLAWPLRKDDTQIREAFQIF 150 >SB_58431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 52.0 bits (119), Expect = 4e-07 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = +1 Query: 1 GTIQRRLAWPLRKDDTQNREAFHIF 75 GTIQRRLAWPLRKDDTQ REAF IF Sbjct: 14 GTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_54126| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 52.0 bits (119), Expect = 4e-07 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = +1 Query: 1 GTIQRRLAWPLRKDDTQNREAFHIF 75 GTIQRRLAWPLRKDDTQ REAF IF Sbjct: 14 GTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_45758| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 52.0 bits (119), Expect = 4e-07 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = +1 Query: 1 GTIQRRLAWPLRKDDTQNREAFHIF 75 GTIQRRLAWPLRKDDTQ REAF IF Sbjct: 14 GTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_44961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 52.0 bits (119), Expect = 4e-07 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = +1 Query: 1 GTIQRRLAWPLRKDDTQNREAFHIF 75 GTIQRRLAWPLRKDDTQ REAF IF Sbjct: 14 GTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_44549| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 52.0 bits (119), Expect = 4e-07 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = +1 Query: 1 GTIQRRLAWPLRKDDTQNREAFHIF 75 GTIQRRLAWPLRKDDTQ REAF IF Sbjct: 14 GTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_36128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 85 Score = 52.0 bits (119), Expect = 4e-07 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = +1 Query: 1 GTIQRRLAWPLRKDDTQNREAFHIF 75 GTIQRRLAWPLRKDDTQ REAF IF Sbjct: 14 GTIQRRLAWPLRKDDTQIREAFQIF 38 Score = 52.0 bits (119), Expect = 4e-07 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = +1 Query: 1 GTIQRRLAWPLRKDDTQNREAFHIF 75 GTIQRRLAWPLRKDDTQ REAF IF Sbjct: 56 GTIQRRLAWPLRKDDTQIREAFQIF 80 >SB_35247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 52.0 bits (119), Expect = 4e-07 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = +1 Query: 1 GTIQRRLAWPLRKDDTQNREAFHIF 75 GTIQRRLAWPLRKDDTQ REAF IF Sbjct: 14 GTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_34984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 52.0 bits (119), Expect = 4e-07 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = +1 Query: 1 GTIQRRLAWPLRKDDTQNREAFHIF 75 GTIQRRLAWPLRKDDTQ REAF IF Sbjct: 14 GTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_34197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 52.0 bits (119), Expect = 4e-07 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = +1 Query: 1 GTIQRRLAWPLRKDDTQNREAFHIF 75 GTIQRRLAWPLRKDDTQ REAF IF Sbjct: 14 GTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_32036| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 85 Score = 52.0 bits (119), Expect = 4e-07 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = +1 Query: 1 GTIQRRLAWPLRKDDTQNREAFHIF 75 GTIQRRLAWPLRKDDTQ REAF IF Sbjct: 14 GTIQRRLAWPLRKDDTQIREAFQIF 38 Score = 52.0 bits (119), Expect = 4e-07 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = +1 Query: 1 GTIQRRLAWPLRKDDTQNREAFHIF 75 GTIQRRLAWPLRKDDTQ REAF IF Sbjct: 56 GTIQRRLAWPLRKDDTQIREAFQIF 80 >SB_28547| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 52.0 bits (119), Expect = 4e-07 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = +1 Query: 1 GTIQRRLAWPLRKDDTQNREAFHIF 75 GTIQRRLAWPLRKDDTQ REAF IF Sbjct: 14 GTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_26763| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 52.0 bits (119), Expect = 4e-07 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = +1 Query: 1 GTIQRRLAWPLRKDDTQNREAFHIF 75 GTIQRRLAWPLRKDDTQ REAF IF Sbjct: 14 GTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_26757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 52.0 bits (119), Expect = 4e-07 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = +1 Query: 1 GTIQRRLAWPLRKDDTQNREAFHIF 75 GTIQRRLAWPLRKDDTQ REAF IF Sbjct: 14 GTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_26470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 52.0 bits (119), Expect = 4e-07 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = +1 Query: 1 GTIQRRLAWPLRKDDTQNREAFHIF 75 GTIQRRLAWPLRKDDTQ REAF IF Sbjct: 14 GTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_24001| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 52.0 bits (119), Expect = 4e-07 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = +1 Query: 1 GTIQRRLAWPLRKDDTQNREAFHIF 75 GTIQRRLAWPLRKDDTQ REAF IF Sbjct: 14 GTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_23476| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 52.0 bits (119), Expect = 4e-07 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = +1 Query: 1 GTIQRRLAWPLRKDDTQNREAFHIF 75 GTIQRRLAWPLRKDDTQ REAF IF Sbjct: 14 GTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_23166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 52.0 bits (119), Expect = 4e-07 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = +1 Query: 1 GTIQRRLAWPLRKDDTQNREAFHIF 75 GTIQRRLAWPLRKDDTQ REAF IF Sbjct: 14 GTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_19253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 52.0 bits (119), Expect = 4e-07 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = +1 Query: 1 GTIQRRLAWPLRKDDTQNREAFHIF 75 GTIQRRLAWPLRKDDTQ REAF IF Sbjct: 14 GTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_13603| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 85 Score = 52.0 bits (119), Expect = 4e-07 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = +1 Query: 1 GTIQRRLAWPLRKDDTQNREAFHIF 75 GTIQRRLAWPLRKDDTQ REAF IF Sbjct: 14 GTIQRRLAWPLRKDDTQIREAFQIF 38 Score = 52.0 bits (119), Expect = 4e-07 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = +1 Query: 1 GTIQRRLAWPLRKDDTQNREAFHIF 75 GTIQRRLAWPLRKDDTQ REAF IF Sbjct: 56 GTIQRRLAWPLRKDDTQIREAFQIF 80 >SB_13164| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 52.0 bits (119), Expect = 4e-07 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = +1 Query: 1 GTIQRRLAWPLRKDDTQNREAFHIF 75 GTIQRRLAWPLRKDDTQ REAF IF Sbjct: 14 GTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_11232| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 52.0 bits (119), Expect = 4e-07 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = +1 Query: 1 GTIQRRLAWPLRKDDTQNREAFHIF 75 GTIQRRLAWPLRKDDTQ REAF IF Sbjct: 14 GTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_7675| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 52.0 bits (119), Expect = 4e-07 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = +1 Query: 1 GTIQRRLAWPLRKDDTQNREAFHIF 75 GTIQRRLAWPLRKDDTQ REAF IF Sbjct: 14 GTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_4220| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 52.0 bits (119), Expect = 4e-07 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = +1 Query: 1 GTIQRRLAWPLRKDDTQNREAFHIF 75 GTIQRRLAWPLRKDDTQ REAF IF Sbjct: 14 GTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_1385| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 52.0 bits (119), Expect = 4e-07 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = +1 Query: 1 GTIQRRLAWPLRKDDTQNREAFHIF 75 GTIQRRLAWPLRKDDTQ REAF IF Sbjct: 14 GTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_951| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 52.0 bits (119), Expect = 4e-07 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = +1 Query: 1 GTIQRRLAWPLRKDDTQNREAFHIF 75 GTIQRRLAWPLRKDDTQ REAF IF Sbjct: 14 GTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_23705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 50.8 bits (116), Expect = 1e-06 Identities = 22/25 (88%), Positives = 23/25 (92%) Frame = +1 Query: 1 GTIQRRLAWPLRKDDTQNREAFHIF 75 GTIQRRLAWPLRKDDTQ REAF +F Sbjct: 14 GTIQRRLAWPLRKDDTQIREAFQMF 38 >SB_3186| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 49.6 bits (113), Expect = 2e-06 Identities = 22/24 (91%), Positives = 22/24 (91%) Frame = +1 Query: 1 GTIQRRLAWPLRKDDTQNREAFHI 72 GTIQRRLAWPLRKDDTQ REAF I Sbjct: 14 GTIQRRLAWPLRKDDTQIREAFQI 37 >SB_7199| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 49.6 bits (113), Expect = 2e-06 Identities = 22/24 (91%), Positives = 22/24 (91%) Frame = +1 Query: 4 TIQRRLAWPLRKDDTQNREAFHIF 75 TIQRRLAWPLRKDDTQ REAF IF Sbjct: 15 TIQRRLAWPLRKDDTQIREAFQIF 38 >SB_30177| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 643 Score = 40.3 bits (90), Expect = 0.001 Identities = 28/80 (35%), Positives = 43/80 (53%), Gaps = 3/80 (3%) Frame = +1 Query: 262 GLKPKAYLRDFTYVAQDPVDQLLLGPAYGIPKILDKVGLKVNDIDTWEIHEAFAGQILAN 441 GL P A L ++ DP + +GP I L++ G ++D+D E++EAFA Q LA Sbjct: 37 GLTPLARLVSYSINGVDPAI-MGIGPVPSIKCALERAGKTLDDMDIIEVNEAFAPQFLAV 95 Query: 442 LKALD---SRSGTSGAARSL 492 K L S++ +G A +L Sbjct: 96 QKDLGLDMSKTNVNGGAIAL 115 >SB_12473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 387 Score = 38.7 bits (86), Expect = 0.004 Identities = 22/52 (42%), Positives = 30/52 (57%), Gaps = 2/52 (3%) Frame = +1 Query: 304 AQDPVDQLLLG--PAYGIPKILDKVGLKVNDIDTWEIHEAFAGQILANLKAL 453 AQ VD ++G P K L K G KV D+D +E++EAFA Q A ++ L Sbjct: 286 AQAGVDPSVMGTGPIPATRKALSKAGWKVEDVDLFELNEAFAAQSCAVIREL 337 Score = 35.9 bits (79), Expect = 0.030 Identities = 20/43 (46%), Positives = 26/43 (60%), Gaps = 1/43 (2%) Frame = +2 Query: 134 EQLAKLKPAFI-KPHGTVTAANASFLTDGASACLXMSEAKARS 259 E L KLKP F+ GTV+A N S L DGA+ + M A+A + Sbjct: 231 EGLRKLKPCFLFDGKGTVSAGNTSGLNDGAAVVVLMPYAEANA 273 >SB_18205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 32.7 bits (71), Expect = 0.28 Identities = 20/41 (48%), Positives = 24/41 (58%), Gaps = 3/41 (7%) Frame = +2 Query: 287 GTSHTSLRIPWTSCCWGP--PTAFPR-SWTKSASRSTISTR 400 GT+ S +PWTS +GP P PR SW +RST STR Sbjct: 54 GTTRISW-MPWTSRMYGPYGPDGTPRISWLPRITRSTSSTR 93 >SB_14249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 32.3 bits (70), Expect = 0.37 Identities = 15/49 (30%), Positives = 23/49 (46%) Frame = +2 Query: 257 SSASNRRPTCGTSHTSLRIPWTSCCWGPPTAFPRSWTKSASRSTISTRG 403 S+ + T +S + I + CC P + F R WT S R + + RG Sbjct: 22 SAGAGIASTLASSSMGMSISFIICCISPSSIFIRFWTASLCRRSCTARG 70 >SB_42356| Best HMM Match : PDZ (HMM E-Value=5.7e-19) Length = 619 Score = 31.5 bits (68), Expect = 0.64 Identities = 17/55 (30%), Positives = 25/55 (45%) Frame = +3 Query: 336 ARLRHSQDLGQSRPQGQRYRHVGDP*GLCGTNPGELEGSRLEKWNKWGGSLSIGH 500 +++R GQ R + + R GDP G G P +G R+E W G G+ Sbjct: 135 SQMRGRSAAGQGRSEVVKSRRGGDPMGSIGLVPQGRDGERIEGPQGWSGEPRRGY 189 >SB_5571| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 587 Score = 31.1 bits (67), Expect = 0.84 Identities = 15/60 (25%), Positives = 28/60 (46%) Frame = -2 Query: 629 LSSSMATPXSSRAAGRDDSKLPVLPHQPGEPCASPDETRWREWMSDRERAAPLVPLLESR 450 + +++ + R AG DD P++P P + + P + W+ + +R PL P R Sbjct: 8 IDNTLPDASADRGAG-DDETTPLIPFDPDDGESIPMTSTSSPWLREAQRKRPLKPRSSQR 66 >SB_7831| Best HMM Match : RNA_pol_Rpb1_7 (HMM E-Value=0) Length = 1467 Score = 30.7 bits (66), Expect = 1.1 Identities = 22/63 (34%), Positives = 29/63 (46%), Gaps = 3/63 (4%) Frame = -3 Query: 577 TPNCPSSRTSPVSRVHRQTKPGGANGCPIESEPPHLFHFSSREPS---SSPGFVPQRPHG 407 +P+ PSS SP S + T P + P S P +S PS +SP + P P Sbjct: 441 SPSSPSSGYSPASPSYSPTSPSYSPTSP--SYSPTSPSYSPTSPSYSPTSPSYSPTSPSY 498 Query: 406 SPT 398 SPT Sbjct: 499 SPT 501 >SB_48069| Best HMM Match : DUF746 (HMM E-Value=4.5) Length = 232 Score = 30.3 bits (65), Expect = 1.5 Identities = 15/46 (32%), Positives = 28/46 (60%) Frame = -1 Query: 450 SLQVRQDLSRKGLMDLPRVDIVDLEADFVQDLGNAVGGPQQQLVHG 313 S+Q+ ++L +KGLMD + + +E + +L N G P+ Q+ +G Sbjct: 65 SVQLNEELKKKGLMDEELDNRIGIELEL--ELDNPNGHPEDQIPNG 108 >SB_30176| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1012 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/23 (69%), Positives = 18/23 (78%) Frame = +2 Query: 134 EQLAKLKPAFIKPHGTVTAANAS 202 EQLAKL PA K +GTV+A NAS Sbjct: 888 EQLAKL-PAVFKKNGTVSAGNAS 909 >SB_19024| Best HMM Match : Thiolase_C (HMM E-Value=5.4e-36) Length = 330 Score = 30.3 bits (65), Expect = 1.5 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +1 Query: 355 KILDKVGLKVNDIDTWEIHEAFAGQILANLKAL 453 ++ DK GL D+D E+H+ F+ L +AL Sbjct: 29 RLFDKTGLSPKDVDVVELHDCFSTNELLTYEAL 61 >SB_14689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1900 Score = 30.3 bits (65), Expect = 1.5 Identities = 25/82 (30%), Positives = 39/82 (47%), Gaps = 4/82 (4%) Frame = +1 Query: 370 VGLKVNDIDTWEIHEAFAGQILANLKALDSRSGTSGAARSLS--DIHSRHRVSSGDAHGS 543 VGL V DID E ++ L ++S + + + S ++HS RV+ + HG Sbjct: 406 VGLSVGDIDKIEQSALIDRYVMQVGAYLSTKSMATFSRKRFSGTELHSLCRVALSNTHGI 465 Query: 544 PGWCGRTG-SLESSRP-AARED 603 G C +T + +RP AR D Sbjct: 466 RGGCLQTDVGVHLARPNVARRD 487 >SB_1573| Best HMM Match : Thiolase_C (HMM E-Value=1.6e-40) Length = 331 Score = 30.3 bits (65), Expect = 1.5 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +1 Query: 355 KILDKVGLKVNDIDTWEIHEAFAGQILANLKAL 453 ++ DK GL D+D E+H+ F+ L +AL Sbjct: 174 RLFDKTGLSPKDVDVVELHDCFSTNELLTYEAL 206 >SB_53740| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0) Length = 1980 Score = 29.9 bits (64), Expect = 1.9 Identities = 27/68 (39%), Positives = 30/68 (44%), Gaps = 2/68 (2%) Frame = -2 Query: 665 LGSLLGWWQSGCL-SSSMATPXSSRAAGRDDSK-LPVLPHQPGEPCASPDETRWREWMSD 492 +G+ L QSG L SS + T R D LPVL HQPG S TR W Sbjct: 1317 MGNTLKVKQSGILISSGVLTLLGQLFRDRSDGDGLPVLQHQPGNVRKSV-RTRKLAWNVP 1375 Query: 491 RERAAPLV 468 R A LV Sbjct: 1376 VTRTAQLV 1383 >SB_24967| Best HMM Match : Drf_FH1 (HMM E-Value=0.65) Length = 1799 Score = 29.1 bits (62), Expect = 3.4 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = -3 Query: 523 TKPGGANGCPIESEPPHLFHFSSREPSSSPGFVPQR 416 T PGG+ G P++ P +L S + S PG P + Sbjct: 227 TLPGGSQGVPVQPLPAYLSTTSVTDLSGFPGQTPDQ 262 >SB_50433| Best HMM Match : MFAP1_C (HMM E-Value=0.24) Length = 536 Score = 28.7 bits (61), Expect = 4.5 Identities = 19/63 (30%), Positives = 32/63 (50%) Frame = -1 Query: 444 QVRQDLSRKGLMDLPRVDIVDLEADFVQDLGNAVGGPQQQLVHGILSDVCEVPQVGLRFE 265 +V+QD R G+ RV L+A +QD ++ G +Q +HGI + + G + Sbjct: 91 KVKQDFER-GVASANRVACRGLDA--IQDACPSLMGSPEQAIHGIAEITWVLTKTGFKVT 147 Query: 264 AEL 256 +EL Sbjct: 148 SEL 150 >SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 28.7 bits (61), Expect = 4.5 Identities = 16/42 (38%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = -3 Query: 523 TKPGGANGCPIESEPPHLFHFSSREP-SSSPGFVPQRPHGSP 401 +KPGG P PP L S P ++PG++P P G P Sbjct: 391 SKPGGILPGPPPPGPPMLNMAPSIPPWQTTPGYIPPPPPGFP 432 >SB_33735| Best HMM Match : Aminotran_1_2 (HMM E-Value=0.13) Length = 383 Score = 28.7 bits (61), Expect = 4.5 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +3 Query: 363 GQSRPQGQRYRHVGDP*GLCGTNP 434 GQ++P + +H+GDP GL G P Sbjct: 54 GQAKPFTEVVKHIGDPQGLQGQKP 77 >SB_4468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1513 Score = 28.7 bits (61), Expect = 4.5 Identities = 14/39 (35%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = -3 Query: 529 RQTK-PGGANGCPIESEPPHLFHFSSREPSSSPGFVPQR 416 RQ K P N P + P +FS R+P P F P++ Sbjct: 316 RQAKIPADINNNPDDEIDPDAANFSFRDPEPEPEFTPEK 354 >SB_45599| Best HMM Match : GRP (HMM E-Value=0.22) Length = 595 Score = 28.7 bits (61), Expect = 4.5 Identities = 20/52 (38%), Positives = 21/52 (40%), Gaps = 2/52 (3%) Frame = -3 Query: 448 PSSSPGFVPQRPHGSPTC--RYR*P*GRLCPRSWECRRRAPTAAGPRDPERR 299 P +SP F P R H P R R P S R RAP R P RR Sbjct: 341 PPTSPSFTPGRVHSDPETPRRAERVRARRGPGSAIARLRAPLGRVARTPPRR 392 >SB_41306| Best HMM Match : Ribosomal_L19e (HMM E-Value=8.5) Length = 220 Score = 28.7 bits (61), Expect = 4.5 Identities = 20/82 (24%), Positives = 30/82 (36%) Frame = +2 Query: 179 TVTAANASFLTDGASACLXMSEAKARSSASNRRPTCGTSHTSLRIPWTSCCWGPPTAFPR 358 T T A SF T+GA+ L + + + N S IPW C + Sbjct: 14 TQTTAETSFTTEGAATRLGLQSLREKYPDLNENLIREICRRSGEIPWRKCVVAHSSRSRV 73 Query: 359 SWTKSASRSTISTRGRSMRPLR 424 + + +S+ GR R R Sbjct: 74 LGSSNTKQSSEQVIGRGHRECR 95 >SB_31712| Best HMM Match : LIM (HMM E-Value=9e-26) Length = 481 Score = 28.7 bits (61), Expect = 4.5 Identities = 18/73 (24%), Positives = 31/73 (42%), Gaps = 1/73 (1%) Frame = +2 Query: 239 SEAKARSSASNRRPTCGTSHTSLRIPWTSCCWGPPTAFPRS-WTKSASRSTISTRGRSMR 415 S +KA +++N T TS+ S T P + W R T+G ++ Sbjct: 69 SRSKANRNSNNNNNTTSIDATSINRQQESKYTSFDTVLPAAFWLSVTGREKSGTQGTTIC 128 Query: 416 PLRDKSWRT*RLS 454 +R+ WR R++ Sbjct: 129 DVREDLWRQFRIT 141 >SB_15482| Best HMM Match : LIM (HMM E-Value=0) Length = 349 Score = 28.7 bits (61), Expect = 4.5 Identities = 18/73 (24%), Positives = 31/73 (42%), Gaps = 1/73 (1%) Frame = +2 Query: 239 SEAKARSSASNRRPTCGTSHTSLRIPWTSCCWGPPTAFPRS-WTKSASRSTISTRGRSMR 415 S +KA +++N T TS+ S T P + W R T+G ++ Sbjct: 167 SRSKANRNSNNNNNTTSIDATSINRQQESKYTSFDTVLPAAFWLSVTGREKSGTQGTTIC 226 Query: 416 PLRDKSWRT*RLS 454 +R+ WR R++ Sbjct: 227 DVREDLWRQFRIT 239 >SB_16403| Best HMM Match : Candida_ALS (HMM E-Value=1.7) Length = 2372 Score = 28.3 bits (60), Expect = 5.9 Identities = 13/42 (30%), Positives = 23/42 (54%) Frame = +1 Query: 463 SGTSGAARSLSDIHSRHRVSSGDAHGSPGWCGRTGSLESSRP 588 S + S++++H R R + G+ GS R+ S++S RP Sbjct: 448 SSLQKVSSSITNMHQRMRNARGNLQGSRQGLNRSQSIQSGRP 489 >SB_12155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 298 Score = 28.3 bits (60), Expect = 5.9 Identities = 18/59 (30%), Positives = 27/59 (45%) Frame = +1 Query: 373 GLKVNDIDTWEIHEAFAGQILANLKALDSRSGTSGAARSLSDIHSRHRVSSGDAHGSPG 549 GL+ D+D +E+H+ F+ L +AL G L D H S+G G+ G Sbjct: 162 GLQAQDVDVFEVHDCFSCNELFMYEALGLCG--EGKGGQLIDEAKWHTNSAGHPIGATG 218 >SB_28656| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 355 Score = 28.3 bits (60), Expect = 5.9 Identities = 16/51 (31%), Positives = 25/51 (49%) Frame = +1 Query: 496 DIHSRHRVSSGDAHGSPGWCGRTGSLESSRPAAREDXGVAMLLERHPDCHH 648 D ++RH S +A G G+ S +SS PA+ V L +++ HH Sbjct: 43 DDNARHSRSPLEAGSRTGMAGKWRSSQSSSPASSSPRRVKELTDKNLVSHH 93 >SB_26630| Best HMM Match : ig (HMM E-Value=0.0021) Length = 333 Score = 28.3 bits (60), Expect = 5.9 Identities = 26/97 (26%), Positives = 40/97 (41%), Gaps = 10/97 (10%) Frame = +2 Query: 167 KPHGTVTAANASFLTDGASACLXMSEAKARSSAS-----NRRPTCGTSHTSLRIPWTSCC 331 KP T+ ANAS + G A L S A ++ S N + H +P+ S Sbjct: 192 KPENTIMVANASSVCIGGMALLNCSAAGKPNNISYTLYRNGKQFASQMHGLFVLPFNSPG 251 Query: 332 WGPPTAFPRS-----WTKSASRSTISTRGRSMRPLRD 427 W T P + KS + + T+ R+ R ++D Sbjct: 252 WSIFTCVPSNEAGDGHNKSVTVTVKVTKSRAPRTVQD 288 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 27.9 bits (59), Expect = 7.9 Identities = 17/49 (34%), Positives = 22/49 (44%), Gaps = 1/49 (2%) Frame = -3 Query: 565 PSSRTSPVSRVHRQTKPGGANGCPIESEP-PHLFHFSSREPSSSPGFVP 422 PS TSP+S H + P SEP P+ S +PS +P P Sbjct: 531 PSISTSPISNPHPSSNPSPHPSSNPSSEPSPNPSSNPSSDPSPNPSSDP 579 >SB_12801| Best HMM Match : TSP_3 (HMM E-Value=2.3e-39) Length = 252 Score = 27.9 bits (59), Expect = 7.9 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +1 Query: 439 NLKALDSRSGTSGAARSLSDIHSRHRVSSGDAHGS 543 NL+ +D+R TSG +R L+D + RV + D S Sbjct: 1 NLQPIDTRLSTSGTSRRLNDRDNCPRVPNPDQANS 35 >SB_27584| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 7381 Score = 27.9 bits (59), Expect = 7.9 Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 4/41 (9%) Frame = -2 Query: 512 WREWMSDRERAAPLVP--LLESRAFK--FARICPAKASWIS 402 WR WMS R VP + A+K FAR+ +SW+S Sbjct: 5924 WRSWMSMRVEVYGCVPPSSFLNNAYKPFFARLHRTSSSWVS 5964 >SB_8223| Best HMM Match : RVT_1 (HMM E-Value=4e-27) Length = 1307 Score = 27.9 bits (59), Expect = 7.9 Identities = 19/64 (29%), Positives = 30/64 (46%), Gaps = 2/64 (3%) Frame = +1 Query: 370 VGLKVNDIDTWEIHEAFAGQILANLKALDSRSGTSGAARSLS--DIHSRHRVSSGDAHGS 543 VGL V DID E ++ L ++S + + + S ++HS RV+ + HG Sbjct: 1120 VGLSVGDIDKIEQSALIDRYVMQVGAYLSTKSMATFSRKRFSGTELHSLCRVALSNTHGI 1179 Query: 544 PGWC 555 G C Sbjct: 1180 RGGC 1183 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,697,796 Number of Sequences: 59808 Number of extensions: 459217 Number of successful extensions: 1532 Number of sequences better than 10.0: 90 Number of HSP's better than 10.0 without gapping: 1406 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1530 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1717720750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -