BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060749.seq (661 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_0544 + 30118208-30118417,30118959-30119063,30119179-301192... 33 0.20 12_02_0639 + 21443480-21443589,21444022-21444211,21444327-214444... 32 0.35 05_03_0187 + 9413575-9414895,9415014-9415289,9415513-9415631,941... 32 0.35 05_03_0065 - 7953414-7953845,7953963-7954081,7954158-7955990,795... 32 0.35 12_02_0642 + 21454142-21454251,21454683-21454872,21454988-214550... 31 0.61 12_02_0633 + 21402847-21402862,21403143-21404975,21405052-214051... 31 0.61 09_02_0396 - 8540532-8540549,8540656-8542129,8542217-8543121 31 0.61 01_04_0076 + 15780981-15780996,15781277-15783109,15783186-157833... 31 0.61 10_08_0173 + 15414628-15414890,15415001-15415074,15416322-154164... 29 3.3 10_06_0043 - 10026817-10027869 29 4.3 02_05_1217 + 34999631-34999945,35000670-35000835,35001908-350020... 29 4.3 11_02_0063 + 7916048-7917135,7917225-7918690,7920177-7920238,792... 28 7.6 11_02_0062 - 7909343-7909413,7909509-7910974,7911064-7912088,791... 28 7.6 04_02_0027 + 8715882-8715928,8716570-8716934,8717147-8717506,871... 28 7.6 >01_06_0544 + 30118208-30118417,30118959-30119063,30119179-30119260, 30119415-30121250,30121327-30121445,30121563-30122006 Length = 931 Score = 33.1 bits (72), Expect = 0.20 Identities = 19/56 (33%), Positives = 27/56 (48%) Frame = -2 Query: 327 HGNFIYENLVIVISLLLAVPSSKTGWKDYSVFSNVKTDKRNRLSNETLNGLLHRKF 160 HG + +L SS +++SVF V T KRNRL +E + L+ KF Sbjct: 751 HGTSTLNLRKLAARILSLTCSSSACERNWSVFEQVHTKKRNRLLHERMRDLVFIKF 806 >12_02_0639 + 21443480-21443589,21444022-21444211,21444327-21444408, 21444563-21445054,21445221-21446246,21446470-21446588, 21446706-21447149 Length = 820 Score = 32.3 bits (70), Expect = 0.35 Identities = 19/56 (33%), Positives = 27/56 (48%) Frame = -2 Query: 327 HGNFIYENLVIVISLLLAVPSSKTGWKDYSVFSNVKTDKRNRLSNETLNGLLHRKF 160 HG + +L SS +++SVF V T KRNRL +E + L+ KF Sbjct: 640 HGTSTPNLRKLAARILSLTCSSSACERNWSVFEQVHTKKRNRLLHERMRDLVFVKF 695 >05_03_0187 + 9413575-9414895,9415014-9415289,9415513-9415631, 9415749-9416192 Length = 719 Score = 32.3 bits (70), Expect = 0.35 Identities = 19/56 (33%), Positives = 27/56 (48%) Frame = -2 Query: 327 HGNFIYENLVIVISLLLAVPSSKTGWKDYSVFSNVKTDKRNRLSNETLNGLLHRKF 160 HG + +L SS +++SVF V T KRNRL +E + L+ KF Sbjct: 539 HGTSTPNLRKLAARILSLTCSSSACERNWSVFEQVHTKKRNRLLHERMRDLVFVKF 594 >05_03_0065 - 7953414-7953845,7953963-7954081,7954158-7955990, 7957103-7957559 Length = 946 Score = 32.3 bits (70), Expect = 0.35 Identities = 19/56 (33%), Positives = 27/56 (48%) Frame = -2 Query: 327 HGNFIYENLVIVISLLLAVPSSKTGWKDYSVFSNVKTDKRNRLSNETLNGLLHRKF 160 HG + +L SS +++SVF V T KRNRL +E + L+ KF Sbjct: 770 HGTSTPNLRKLAARILSLTCSSSACERNWSVFEQVHTKKRNRLLHERMRDLVFVKF 825 >12_02_0642 + 21454142-21454251,21454683-21454872,21454988-21455069, 21455224-21455802,21455854-21456909,21457133-21457251, 21457369-21457812 Length = 859 Score = 31.5 bits (68), Expect = 0.61 Identities = 19/56 (33%), Positives = 27/56 (48%) Frame = -2 Query: 327 HGNFIYENLVIVISLLLAVPSSKTGWKDYSVFSNVKTDKRNRLSNETLNGLLHRKF 160 HG + +L SS +++SVF V T KRNRL +E + L+ KF Sbjct: 679 HGTSTPNLRKLAARILSLTCSSLACERNWSVFEQVHTKKRNRLLHERMRDLVFVKF 734 >12_02_0633 + 21402847-21402862,21403143-21404975,21405052-21405170, 21405288-21405722 Length = 800 Score = 31.5 bits (68), Expect = 0.61 Identities = 19/56 (33%), Positives = 27/56 (48%) Frame = -2 Query: 327 HGNFIYENLVIVISLLLAVPSSKTGWKDYSVFSNVKTDKRNRLSNETLNGLLHRKF 160 HG + +L SS +++SVF V T KRNRL +E + L+ KF Sbjct: 623 HGTSTPNLRKLAARILSLTCSSSACERNWSVFEQVHTKKRNRLLHERMRDLVCVKF 678 >09_02_0396 - 8540532-8540549,8540656-8542129,8542217-8543121 Length = 798 Score = 31.5 bits (68), Expect = 0.61 Identities = 16/43 (37%), Positives = 28/43 (65%) Frame = -2 Query: 300 VIVISLLLAVPSSKTGWKDYSVFSNVKTDKRNRLSNETLNGLL 172 +I +SL+L V ++ + +S S +KTD RN++ +E LN L+ Sbjct: 715 LIELSLILPVATASVE-RVFSAMSLIKTDLRNKMGDEWLNDLM 756 >01_04_0076 + 15780981-15780996,15781277-15783109,15783186-15783304, 15783422-15783724 Length = 756 Score = 31.5 bits (68), Expect = 0.61 Identities = 19/56 (33%), Positives = 27/56 (48%) Frame = -2 Query: 327 HGNFIYENLVIVISLLLAVPSSKTGWKDYSVFSNVKTDKRNRLSNETLNGLLHRKF 160 HG + +L SS +++SVF V T KRNRL +E + L+ KF Sbjct: 623 HGTSTPNLRKLAARILSLTCSSLACERNWSVFEQVDTKKRNRLLHERMRDLVFVKF 678 >10_08_0173 + 15414628-15414890,15415001-15415074,15416322-15416401, 15417186-15417231,15417334-15417368,15417751-15417771, 15418418-15419133,15419292-15419324,15419517-15419813, 15420213-15420659,15420738-15420886,15421408-15421697, 15421774-15421898,15422006-15422156 Length = 908 Score = 29.1 bits (62), Expect = 3.3 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = -3 Query: 452 LGIPQNPNKYNPPNFYLPIFVDVTRTYLYCNIQVLHVP 339 LGI + P + NPP++Y+ I +T+T + + H+P Sbjct: 557 LGI-KVPERENPPDYYIDILEGITKTKMRGHAAPKHLP 593 >10_06_0043 - 10026817-10027869 Length = 350 Score = 28.7 bits (61), Expect = 4.3 Identities = 20/63 (31%), Positives = 27/63 (42%), Gaps = 3/63 (4%) Frame = -1 Query: 427 SIIRRTFIYLFSLMSPELTCIVIYRYFMYHERLSW---*FHLRKPCNCHFTFASSSFFKD 257 SI ++YL L EL C+ + M HE L W F LR +T + F + Sbjct: 49 SIGENPYLYLRDL---ELVCLCLSIVGMTHETLKWKLFPFSLRDKAKQWYTMSVKKFHGE 105 Query: 256 WVE 248 W E Sbjct: 106 WEE 108 >02_05_1217 + 34999631-34999945,35000670-35000835,35001908-35002005, 35002245-35002319,35002413-35002481,35002552-35002637, 35002710-35002827,35003575-35003902,35003995-35005682, 35005822-35005881,35005953-35006027,35006105-35006197, 35006298-35006372,35006464-35006532,35006614-35006682, 35006994-35007113 Length = 1167 Score = 28.7 bits (61), Expect = 4.3 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = -1 Query: 283 FASSSFFKDWVERLFSVLKCKN*QKKQ 203 ++SSSF K W+E+L + K KN + K+ Sbjct: 741 YSSSSFLKPWLEKLALLFKDKNSKLKE 767 >11_02_0063 + 7916048-7917135,7917225-7918690,7920177-7920238, 7921808-7922407 Length = 1071 Score = 27.9 bits (59), Expect = 7.6 Identities = 16/51 (31%), Positives = 31/51 (60%) Frame = -2 Query: 333 DYHGNFIYENLVIVISLLLAVPSSKTGWKDYSVFSNVKTDKRNRLSNETLN 181 D H F +I ++L+L V ++ T + +S + +KT+ RN++++E LN Sbjct: 764 DRHTVFPLVYRLIELALILPVATA-TVERAFSAMNIIKTELRNKMADEWLN 813 >11_02_0062 - 7909343-7909413,7909509-7910974,7911064-7912088, 7912300-7912809,7913418-7913441,7913617-7913673 Length = 1050 Score = 27.9 bits (59), Expect = 7.6 Identities = 16/51 (31%), Positives = 31/51 (60%) Frame = -2 Query: 333 DYHGNFIYENLVIVISLLLAVPSSKTGWKDYSVFSNVKTDKRNRLSNETLN 181 D H F +I ++L+L V ++ T + +S + +KT+ RN++++E LN Sbjct: 940 DRHTVFPLVYRLIELALILPVATA-TVERAFSAMNIIKTELRNKMADEWLN 989 >04_02_0027 + 8715882-8715928,8716570-8716934,8717147-8717506, 8718063-8718576,8718657-8718684 Length = 437 Score = 27.9 bits (59), Expect = 7.6 Identities = 16/57 (28%), Positives = 32/57 (56%), Gaps = 1/57 (1%) Frame = -2 Query: 339 MKDYHGNFIYENLVIVISLLLAVP-SSKTGWKDYSVFSNVKTDKRNRLSNETLNGLL 172 M++ + Y + ++ L+L +P ++ T + +S NVKT RN++ +E L+ L Sbjct: 340 MEETRKHLCYPLVYQLLKLVLVLPVATATVERCFSAMKNVKTYLRNKIGDEYLSDSL 396 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,246,824 Number of Sequences: 37544 Number of extensions: 279995 Number of successful extensions: 448 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 444 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 448 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1655832080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -