BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060749.seq (661 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M69216-2|AAA51465.1| 661|Drosophila melanogaster HFL1 protein. 31 1.4 AE014298-754|AAF46045.1| 640|Drosophila melanogaster CG15780-PA... 28 9.8 >M69216-2|AAA51465.1| 661|Drosophila melanogaster HFL1 protein. Length = 661 Score = 31.1 bits (67), Expect = 1.4 Identities = 17/49 (34%), Positives = 30/49 (61%), Gaps = 1/49 (2%) Frame = -2 Query: 315 IYENLVIVISLLLAVP-SSKTGWKDYSVFSNVKTDKRNRLSNETLNGLL 172 +Y L + LL++P SS + +S+ N+ T+KRNRL ++++ LL Sbjct: 600 LYPQLSKLALKLLSIPASSAAAERVFSLAGNIITEKRNRLCPKSVDSLL 648 >AE014298-754|AAF46045.1| 640|Drosophila melanogaster CG15780-PA protein. Length = 640 Score = 28.3 bits (60), Expect = 9.8 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = -2 Query: 294 VISLLLAVPSSKTGWKDYSVFSNVKTDKRNRLSNETLNGLLHR 166 V+ +L + S+ TG YS ++ T NRL + G+LHR Sbjct: 481 VLRVLRSRDSAGTGMLPYSQLRHLLTTMGNRLDETEVYGVLHR 523 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,502,469 Number of Sequences: 53049 Number of extensions: 511511 Number of successful extensions: 914 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 894 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 914 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2827453950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -