BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060749.seq (661 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g13920.1 68417.m02154 disease resistance family protein / LRR... 29 3.6 At3g59340.1 68416.m06616 expressed protein identical to anthocya... 28 4.8 >At4g13920.1 68417.m02154 disease resistance family protein / LRR family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611; similar to Cf-2.2 [Lycopersicon pimpinellifolium] gi|1184077|gb|AAC15780 Length = 891 Score = 28.7 bits (61), Expect = 3.6 Identities = 20/74 (27%), Positives = 33/74 (44%) Frame = -2 Query: 396 FR*CHQNLLVL*YTGTSCTMKDYHGNFIYENLVIVISLLLAVPSSKTGWKDYSVFSNVKT 217 FR H L L Y SCT+ D GNF Y ++ ++ L T + S +++ Sbjct: 102 FRLQHLQSLDLSYNDLSCTLPDSSGNFKYLRVLNLLGCNL-FGEIPTSLRSLSYLTDLDL 160 Query: 216 DKRNRLSNETLNGL 175 + L+ E L+ + Sbjct: 161 SYNDDLTGEILDSM 174 >At3g59340.1 68416.m06616 expressed protein identical to anthocyanin-related membrane protein 3 (GI:16416387) [Arabidopsis thaliana] Length = 333 Score = 28.3 bits (60), Expect = 4.8 Identities = 10/32 (31%), Positives = 22/32 (68%) Frame = -1 Query: 406 IYLFSLMSPELTCIVIYRYFMYHERLSW*FHL 311 ++ SL++ ++ ++I R F YHE++ W ++L Sbjct: 259 MFTLSLLTSDMWAVLI-RIFAYHEKVDWLYYL 289 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,067,891 Number of Sequences: 28952 Number of extensions: 255753 Number of successful extensions: 468 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 464 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 468 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1383534864 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -