BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060748.seq (670 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 23 1.0 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 23 1.0 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 23.4 bits (48), Expect(2) = 1.0 Identities = 15/55 (27%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Frame = +2 Query: 290 TGTRRL-FEYVNNFQQFLNTIRNNFNGPCAKHDMGSSCEDTEEATEKQAVQQTLD 451 TG RR EYV N + + R NF + E EE +A + ++ Sbjct: 2428 TGFRRYRLEYVKNTNKISSVYRTNFAARSGLDETRYQVEHDEEGNVVRATHKGIE 2482 Score = 20.6 bits (41), Expect(2) = 1.0 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +2 Query: 158 EKYKHDSQND*QHFTIFFKR 217 + YK D+ + QHF F+R Sbjct: 2413 QSYKIDANGNHQHFYTGFRR 2432 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 23.4 bits (48), Expect(2) = 1.0 Identities = 15/55 (27%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Frame = +2 Query: 290 TGTRRL-FEYVNNFQQFLNTIRNNFNGPCAKHDMGSSCEDTEEATEKQAVQQTLD 451 TG RR EYV N + + R NF + E EE +A + ++ Sbjct: 2429 TGFRRYRLEYVKNTNKISSVYRTNFAARSGLDETRYQVEHDEEGNVVRATHKGIE 2483 Score = 20.6 bits (41), Expect(2) = 1.0 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +2 Query: 158 EKYKHDSQND*QHFTIFFKR 217 + YK D+ + QHF F+R Sbjct: 2414 QSYKIDANGNHQHFYTGFRR 2433 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 694,927 Number of Sequences: 2352 Number of extensions: 13265 Number of successful extensions: 50 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 46 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 50 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 66904800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -