BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060744.seq (661 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g19390.2 68418.m02311 pleckstrin homology (PH) domain-contain... 29 3.6 At5g19390.1 68418.m02310 pleckstrin homology (PH) domain-contain... 29 3.6 At4g23220.1 68417.m03349 protein kinase family protein contains ... 29 3.6 At5g08630.1 68418.m01026 DDT domain-containing protein low simil... 28 4.8 At2g02790.1 68415.m00222 calmodulin-binding family protein very ... 28 4.8 At5g43490.1 68418.m05317 hypothetical protein similar to unknown... 28 6.3 At4g25320.1 68417.m03643 DNA-binding protein-related contains Pf... 28 6.3 At1g70420.1 68414.m08102 expressed protein 28 6.3 At5g08780.1 68418.m01041 histone H1/H5 family protein contains P... 27 8.4 >At5g19390.2 68418.m02311 pleckstrin homology (PH) domain-containing protein / RhoGAP domain-containing protein weak similarity to rho-GTPase activating protein [Homo sapiens] GI:14245732; contains Pfam profiles PF00169: PH domain, PF00620: RhoGAP domain Length = 870 Score = 28.7 bits (61), Expect = 3.6 Identities = 17/47 (36%), Positives = 22/47 (46%) Frame = +2 Query: 56 QVKIGEFKFGEDTFTLRYVLGDEQPVRFVAKDIASSLKYVNCERAIR 196 Q G F DT +Y+ RF+ +D S+L YVN ER R Sbjct: 691 QTHFGSFSDARDTH--QYLQNHNPQKRFLQQDFDSTLAYVNHERKQR 735 >At5g19390.1 68418.m02310 pleckstrin homology (PH) domain-containing protein / RhoGAP domain-containing protein weak similarity to rho-GTPase activating protein [Homo sapiens] GI:14245732; contains Pfam profiles PF00169: PH domain, PF00620: RhoGAP domain Length = 822 Score = 28.7 bits (61), Expect = 3.6 Identities = 17/47 (36%), Positives = 22/47 (46%) Frame = +2 Query: 56 QVKIGEFKFGEDTFTLRYVLGDEQPVRFVAKDIASSLKYVNCERAIR 196 Q G F DT +Y+ RF+ +D S+L YVN ER R Sbjct: 691 QTHFGSFSDARDTH--QYLQNHNPQKRFLQQDFDSTLAYVNHERKQR 735 >At4g23220.1 68417.m03349 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 542 Score = 28.7 bits (61), Expect = 3.6 Identities = 12/47 (25%), Positives = 23/47 (48%) Frame = +2 Query: 416 YARSKYAPAVEMDTNDVIAKIDDLTQKLTVATQIWRKQTDRSFCLPT 556 Y+ S + +++ + + I +DD+T LT Q+W + R T Sbjct: 4 YSNSSFFGSLKAEPHFYIHNVDDITSNLTEFDQVWEELARRMIASTT 50 >At5g08630.1 68418.m01026 DDT domain-containing protein low similarity to SP|Q9NRL2 Bromodomain adjacent to zinc finger domain protein 1A (ATP-utilizing chromatin assembly and remodeling factor 1) (ATP-dependent chromatin remodelling protein) (Williams syndrome transcription factor-related chromatin remodeling factor 180) {Homo sapiens}; contains Pfam profile PF02791: DDT domain Length = 723 Score = 28.3 bits (60), Expect = 4.8 Identities = 12/42 (28%), Positives = 24/42 (57%) Frame = +2 Query: 374 NYKNGFWRRSFLKCYARSKYAPAVEMDTNDVIAKIDDLTQKL 499 ++K + R+FLK + R ++ ND +AK ++T+K+ Sbjct: 170 SWKKFPFSRNFLKSFIRDSTCHSIPWVVNDYLAKAHEITRKI 211 >At2g02790.1 68415.m00222 calmodulin-binding family protein very low similarity to SP|P12036 Neurofilament triplet H protein {Homo sapiens}; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 636 Score = 28.3 bits (60), Expect = 4.8 Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 4/52 (7%) Frame = +3 Query: 183 NGQYVSTSTASTNRRLSMPTKSSTCSR*RG--KAGR--PAVFAPTHSAHYQI 326 NG S +T ++RR S+P K + G ++GR P+ APT SA +I Sbjct: 472 NGNVASENTKPSDRRASLPAKIENHHQDDGLTQSGRKIPSYMAPTASAKARI 523 >At5g43490.1 68418.m05317 hypothetical protein similar to unknown protein (gb|AAF20218.1) Length = 131 Score = 27.9 bits (59), Expect = 6.3 Identities = 17/55 (30%), Positives = 26/55 (47%), Gaps = 2/55 (3%) Frame = +1 Query: 235 CRPNPAPAPDSVA--KQGDPLYLHPHTVLITKSGVIQLIMKSKLPYAIELQEWLL 393 C P+P A V + G+P PH L + ++ + + LP + QEWLL Sbjct: 33 CPPSPLAATMKVKVKENGEPSAKPPHPDLKYLNQILHVPTRELLPEIDDDQEWLL 87 >At4g25320.1 68417.m03643 DNA-binding protein-related contains Pfam domain PF03479: Domain of unknown function (DUF296), found in AT-hook motifs Pfam:PF02178 Length = 404 Score = 27.9 bits (59), Expect = 6.3 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +3 Query: 201 TSTASTNRRLSMPTKSSTCSR*RGKAGRPAVFAP 302 T A+T L+MPT++++ + + K GRP + P Sbjct: 64 TENAATPFSLTMPTENTSAEQLKKKRGRPRKYNP 97 >At1g70420.1 68414.m08102 expressed protein Length = 272 Score = 27.9 bits (59), Expect = 6.3 Identities = 17/49 (34%), Positives = 26/49 (53%) Frame = +3 Query: 183 NGQYVSTSTASTNRRLSMPTKSSTCSR*RGKAGRPAVFAPTHSAHYQIW 329 NG ++ST+ST RLS KSS + + K + T SAH +++ Sbjct: 187 NGSSSTSSTSSTAARLSGVVKSSEKGKEKTKTDKKKDKMRTKSAHEKLY 235 >At5g08780.1 68418.m01041 histone H1/H5 family protein contains Pfam domain, PF00538: linker histone H1 and H5 family Length = 457 Score = 27.5 bits (58), Expect = 8.4 Identities = 16/48 (33%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Frame = +2 Query: 182 ERAIRVHVDGKYKST-FEHADQIQHLLQIAWQSRATRCICTHTQCSLP 322 E AI + KYK+ F H + + H L + R C C + SLP Sbjct: 77 EDAISEFIKSKYKNLPFAHTNLLSHHLAKLVEKREILCDCNNDCYSLP 124 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,793,176 Number of Sequences: 28952 Number of extensions: 321685 Number of successful extensions: 806 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 789 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 806 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1383534864 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -