BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060743.seq (495 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_33983| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.018 SB_2161| Best HMM Match : Ribosomal_L22e (HMM E-Value=1.1e-05) 36 0.018 SB_19339| Best HMM Match : Transposase_21 (HMM E-Value=5.6e-05) 29 1.6 SB_58789| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.7 >SB_33983| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 35.9 bits (79), Expect = 0.018 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = +2 Query: 371 DWLRVVASAHDAYELRYF 424 DWLRVVA+ H +YELRYF Sbjct: 18 DWLRVVAADHTSYELRYF 35 >SB_2161| Best HMM Match : Ribosomal_L22e (HMM E-Value=1.1e-05) Length = 50 Score = 35.9 bits (79), Expect = 0.018 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = +2 Query: 371 DWLRVVASAHDAYELRYF 424 DWLRVVA+ H +YELRYF Sbjct: 18 DWLRVVAADHTSYELRYF 35 >SB_19339| Best HMM Match : Transposase_21 (HMM E-Value=5.6e-05) Length = 290 Score = 29.5 bits (63), Expect = 1.6 Identities = 15/42 (35%), Positives = 25/42 (59%) Frame = +3 Query: 153 DCTHPAEDSILDVGNFEKYLKEHVKVEGKTNNLSITLSSPGI 278 +C ED I+D N++ + KEHV + NN +I L++ G+ Sbjct: 84 NCPENIED-IIDGENYQLFFKEHVFLR-NPNNFAIQLNTDGV 123 >SB_58789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 987 Score = 28.3 bits (60), Expect = 3.7 Identities = 13/39 (33%), Positives = 22/39 (56%) Frame = -1 Query: 342 FVKYFRYLFEKGMSAVIATFVLSLATTT*CLGYLFCPQL 226 F+ +RY+ G+S ++ + AT C+G LF P+L Sbjct: 755 FIPTYRYVV--GISRILVVVFTAFATAFSCMGCLFIPKL 791 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,666,795 Number of Sequences: 59808 Number of extensions: 218679 Number of successful extensions: 481 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 464 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 481 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1062812967 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -