BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060743.seq (495 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ989011-1|ABK97612.1| 467|Anopheles gambiae gustatory receptor... 24 3.3 AY705403-1|AAU12512.1| 520|Anopheles gambiae nicotinic acetylch... 23 7.6 DQ974174-1|ABJ52814.1| 391|Anopheles gambiae serpin 18 protein. 22 10.0 AY705395-1|AAU12504.1| 569|Anopheles gambiae nicotinic acetylch... 22 10.0 AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 22 10.0 AF387862-2|AAL56548.1| 942|Anopheles gambiae pol polyprotein pr... 22 10.0 >DQ989011-1|ABK97612.1| 467|Anopheles gambiae gustatory receptor 22 protein. Length = 467 Score = 23.8 bits (49), Expect = 3.3 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +2 Query: 104 NPRQRHQAED*LKIYNRLH 160 NP QR Q ED +I +LH Sbjct: 19 NPNQRQQLEDRRRIKEQLH 37 >AY705403-1|AAU12512.1| 520|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 8 protein. Length = 520 Score = 22.6 bits (46), Expect = 7.6 Identities = 14/33 (42%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = +2 Query: 62 IASEDWQKRSE-GWQNPRQRHQAED*LKIYNRL 157 +AS Q RS G NP + +D L YNRL Sbjct: 12 VASSSAQGRSSHGRANPDAKRLYDDLLSNYNRL 44 >DQ974174-1|ABJ52814.1| 391|Anopheles gambiae serpin 18 protein. Length = 391 Score = 22.2 bits (45), Expect = 10.0 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = +3 Query: 171 EDSILDVGNFEKYL 212 + ++L VGNF KY+ Sbjct: 372 DGNVLQVGNFSKYI 385 >AY705395-1|AAU12504.1| 569|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 2 protein. Length = 569 Score = 22.2 bits (45), Expect = 10.0 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +2 Query: 98 WQNPRQRHQAED*LKIYNRL 157 W NP + +D L YNRL Sbjct: 31 WANPDAKRLYDDLLSNYNRL 50 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 22.2 bits (45), Expect = 10.0 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = +3 Query: 147 TIDCTHPAEDSILDVGNFEKY 209 T++CT + SI+ NF K+ Sbjct: 503 TLECTSASGYSIVSTSNFNKH 523 >AF387862-2|AAL56548.1| 942|Anopheles gambiae pol polyprotein protein. Length = 942 Score = 22.2 bits (45), Expect = 10.0 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +3 Query: 339 QNVTSRRTICVTGFEWW 389 QN++S R+I T FE W Sbjct: 214 QNISSSRSIEKTPFELW 230 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 429,150 Number of Sequences: 2352 Number of extensions: 8096 Number of successful extensions: 10 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 43977336 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -