BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060743.seq (495 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U58760-2|AAK31460.1| 130|Caenorhabditis elegans Ribosomal prote... 46 1e-05 U58760-3|AAL02443.1| 53|Caenorhabditis elegans Ribosomal prote... 27 7.5 AF045641-5|AAC02577.2| 554|Caenorhabditis elegans Hypothetical ... 27 7.5 AC084197-3|AAN63427.1| 173|Caenorhabditis elegans Histone h1 li... 24 9.3 >U58760-2|AAK31460.1| 130|Caenorhabditis elegans Ribosomal protein, large subunitprotein 22, isoform a protein. Length = 130 Score = 46.4 bits (105), Expect = 1e-05 Identities = 18/40 (45%), Positives = 28/40 (70%) Frame = +3 Query: 135 NLKFTIDCTHPAEDSILDVGNFEKYLKEHVKVEGKTNNLS 254 +LKF ++C +P ED IL + + E +L E +KV GKT +L+ Sbjct: 20 HLKFNVECKNPVEDGILRIEDLEAFLNEKIKVNGKTGHLA 59 Score = 40.7 bits (91), Expect = 6e-04 Identities = 20/57 (35%), Positives = 30/57 (52%) Frame = +2 Query: 254 HHVVVARDKTKVAITADIPFSXXXXXXXXXXXXXXXXXXDWLRVVASAHDAYELRYF 424 ++V V K+KV++ +++PFS DWLRVVA + YE+RYF Sbjct: 61 NNVKVEVAKSKVSVVSEVPFSKRYLKYLTKKYLKRNSLRDWLRVVAVNKNTYEVRYF 117 >U58760-3|AAL02443.1| 53|Caenorhabditis elegans Ribosomal protein, large subunitprotein 22, isoform b protein. Length = 53 Score = 27.1 bits (57), Expect = 7.5 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = +3 Query: 135 NLKFTIDCTHPAEDSILDV 191 +LKF ++C +P ED IL + Sbjct: 20 HLKFNVECKNPVEDGILRI 38 >AF045641-5|AAC02577.2| 554|Caenorhabditis elegans Hypothetical protein F53H1.3 protein. Length = 554 Score = 27.1 bits (57), Expect = 7.5 Identities = 16/42 (38%), Positives = 20/42 (47%) Frame = -2 Query: 275 PWRRQRDA*VICFALNFDVFLQVFLEVTYV*DTILSGMRAVD 150 PW R RD + FD+ L LEV Y D ILS ++ Sbjct: 7 PWDRFRDWLHCICVVTFDLELGQALEVIYPGDAILSNTEKIN 48 >AC084197-3|AAN63427.1| 173|Caenorhabditis elegans Histone h1 like protein 2, isoformb protein. Length = 173 Score = 23.8 bits (49), Expect(2) = 9.3 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +3 Query: 12 SFATMAVTKKPVAKK 56 + T A TKKPVAKK Sbjct: 93 NMVTAAATKKPVAKK 107 Score = 21.4 bits (43), Expect(2) = 9.3 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +3 Query: 30 VTKKPVAKKA 59 V KKPVAKKA Sbjct: 104 VAKKPVAKKA 113 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,345,016 Number of Sequences: 27780 Number of extensions: 161603 Number of successful extensions: 390 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 381 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 390 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 935344784 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -