BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060742.seq (677 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g02870.1 68418.m00230 60S ribosomal protein L4/L1 (RPL4D) 60S... 120 9e-28 At3g09630.1 68416.m01142 60S ribosomal protein L4/L1 (RPL4A) str... 120 9e-28 At1g76010.1 68414.m08825 expressed protein 30 1.2 At1g57750.1 68414.m06552 cytochrome P450, putative similar to cy... 29 2.1 At1g48410.2 68414.m05409 argonaute protein (AGO1) identical to S... 29 2.8 At1g48410.1 68414.m05408 argonaute protein (AGO1) identical to S... 29 2.8 At5g07520.1 68418.m00861 glycine-rich protein (GRP18) Oleosin; g... 28 4.9 At4g39480.1 68417.m05585 cytochrome P450 family protein contains... 28 4.9 At5g17650.1 68418.m02069 glycine/proline-rich protein glycine/pr... 28 6.5 At5g55100.2 68418.m06869 SWAP (Suppressor-of-White-APricot)/surp... 27 8.6 At5g55100.1 68418.m06868 SWAP (Suppressor-of-White-APricot)/surp... 27 8.6 At1g80480.1 68414.m09427 PRLI-interacting factor L, putative sim... 27 8.6 >At5g02870.1 68418.m00230 60S ribosomal protein L4/L1 (RPL4D) 60S roibosomal protein L4, Arabidopsis thaliana, EMBL:CAA79104 Length = 407 Score = 120 bits (289), Expect = 9e-28 Identities = 55/94 (58%), Positives = 59/94 (62%) Frame = +3 Query: 255 AGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRRWHXXXXX 434 AGHQTSAESWGTGRAV+RIPRV GGGTHR+GQ AFGNMCRGGRMFAPTK WRRWH Sbjct: 64 AGHQTSAESWGTGRAVSRIPRVPGGGTHRAGQAAFGNMCRGGRMFAPTKIWRRWHRRVNV 123 Query: 435 XXXXXXXXXXXXXXXXXXXXQARGQLLKRFPNFP 536 ARG ++ P P Sbjct: 124 NMKRHAIVSAIAATAVPALVMARGHKIENVPEMP 157 Score = 58.4 bits (135), Expect = 4e-09 Identities = 30/59 (50%), Positives = 37/59 (62%), Gaps = 2/59 (3%) Frame = +1 Query: 85 SVARPLVSVYSEKSE--TVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVSKE 255 + ARPLV+V + T Q LP V AP+RPD+VN VH +S NSRQPY VSK+ Sbjct: 5 AAARPLVTVQGLDGDMSTDQSTTVTLPDVMTAPVRPDIVNFVHAQISNNSRQPYAVSKK 63 Score = 56.0 bits (129), Expect = 2e-08 Identities = 25/55 (45%), Positives = 36/55 (65%) Frame = +2 Query: 512 IEKIPELPLVVADKVQEINKTKQAVIFLRRLKAWSDILKVYKSQRLRAGKGKMRN 676 IE +PE+PLVV+D + + KT A+ L+++ A+ D K S +R GKGKMRN Sbjct: 150 IENVPEMPLVVSDSAEAVEKTSAAIKVLKQIGAYDDAEKAKNSIGIRPGKGKMRN 204 >At3g09630.1 68416.m01142 60S ribosomal protein L4/L1 (RPL4A) strong similarity to 60S ribosomal protein L1 GB:P49691 Length = 406 Score = 120 bits (289), Expect = 9e-28 Identities = 55/94 (58%), Positives = 59/94 (62%) Frame = +3 Query: 255 AGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRRWHXXXXX 434 AGHQTSAESWGTGRAV+RIPRV GGGTHR+GQ AFGNMCRGGRMFAPTK WRRWH Sbjct: 63 AGHQTSAESWGTGRAVSRIPRVPGGGTHRAGQAAFGNMCRGGRMFAPTKIWRRWHRRVNV 122 Query: 435 XXXXXXXXXXXXXXXXXXXXQARGQLLKRFPNFP 536 ARG ++ P P Sbjct: 123 NMKRHAIVSAIAATAVPALVMARGHKIENVPEMP 156 Score = 60.5 bits (140), Expect = 1e-09 Identities = 30/62 (48%), Positives = 41/62 (66%), Gaps = 2/62 (3%) Frame = +1 Query: 76 MSLSVARPLVSVYSEKSE--TVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVS 249 M+ + ARPLV++ + + T Q + LP V AP+RPD+VN VH +S NSRQPY VS Sbjct: 1 MAAAAARPLVTIQTLDGDMSTDQSSTVVLPDVMTAPVRPDIVNFVHAQISNNSRQPYAVS 60 Query: 250 KE 255 K+ Sbjct: 61 KK 62 Score = 56.0 bits (129), Expect = 2e-08 Identities = 25/55 (45%), Positives = 36/55 (65%) Frame = +2 Query: 512 IEKIPELPLVVADKVQEINKTKQAVIFLRRLKAWSDILKVYKSQRLRAGKGKMRN 676 IE +PE+PLVV+D + + KT A+ L+++ A+ D K S +R GKGKMRN Sbjct: 149 IENVPEMPLVVSDSAEAVEKTSAAIKVLKQIGAYDDAEKAKNSIGIRPGKGKMRN 203 >At1g76010.1 68414.m08825 expressed protein Length = 350 Score = 30.3 bits (65), Expect = 1.2 Identities = 18/43 (41%), Positives = 19/43 (44%) Frame = +3 Query: 249 QGAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRG 377 QG G + G GR R R RGGG R G G F N G Sbjct: 303 QGRGGYDGPQGRGRGRGRGRGGRGRGGG--RGGDGGFNNRSDG 343 >At1g57750.1 68414.m06552 cytochrome P450, putative similar to cytochrome P450 GI:4688670 from [Catharanthus roseus] Length = 497 Score = 29.5 bits (63), Expect = 2.1 Identities = 16/49 (32%), Positives = 29/49 (59%) Frame = +1 Query: 100 LVSVYSEKSETVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCV 246 LV +++ SE+++ PLPF K+P +PD++ H + NS+ C+ Sbjct: 351 LVYLHAALSESMR-LYPPLPFNHKSPAKPDVLPSGH-KVDANSKIVICI 397 >At1g48410.2 68414.m05409 argonaute protein (AGO1) identical to SP|O04379 Argonaute protein (AGO1) {Arabidopsis thaliana}; contains Pfam profiles PF02171: Piwi domain, PF02170: PAZ domain Length = 1050 Score = 29.1 bits (62), Expect = 2.8 Identities = 15/45 (33%), Positives = 23/45 (51%) Frame = +3 Query: 249 QGAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGR 383 +G+G + + G GR R +GGG H+ G+G +GGR Sbjct: 15 EGSGSREAGPVSGGGRGSQRGGFQQGGGQHQGGRGYTPQPQQGGR 59 >At1g48410.1 68414.m05408 argonaute protein (AGO1) identical to SP|O04379 Argonaute protein (AGO1) {Arabidopsis thaliana}; contains Pfam profiles PF02171: Piwi domain, PF02170: PAZ domain Length = 1048 Score = 29.1 bits (62), Expect = 2.8 Identities = 15/45 (33%), Positives = 23/45 (51%) Frame = +3 Query: 249 QGAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGR 383 +G+G + + G GR R +GGG H+ G+G +GGR Sbjct: 15 EGSGSREAGPVSGGGRGSQRGGFQQGGGQHQGGRGYTPQPQQGGR 59 >At5g07520.1 68418.m00861 glycine-rich protein (GRP18) Oleosin; glycine-rich protein 18 (GRP18) PMID:11431566; Length = 228 Score = 28.3 bits (60), Expect = 4.9 Identities = 18/64 (28%), Positives = 29/64 (45%), Gaps = 3/64 (4%) Frame = +3 Query: 225 LEAALLREQGAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQ---GAFGNMCRGGRMFAP 395 + AL+R + G + +AE + + + ++P G G G+ G FGN GG F Sbjct: 76 MAVALIRRR-MGAKPTAEGTSSAQPLLKLPVYGGYGGFWGGKKFSGTFGNKPGGGNPFGD 134 Query: 396 TKPW 407 W Sbjct: 135 ISKW 138 >At4g39480.1 68417.m05585 cytochrome P450 family protein contains Pfam profile: PF00067 cytochrome P450 Length = 989 Score = 28.3 bits (60), Expect = 4.9 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +1 Query: 151 PLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCV 246 P+PF K+P +PD++ H + NSR +C+ Sbjct: 384 PVPFNHKSPAKPDVLPSGH-KVKANSRILFCL 414 Score = 27.5 bits (58), Expect = 8.6 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = +1 Query: 151 PLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCV 246 P+PF K+P +PD++ H + NS+ +C+ Sbjct: 857 PVPFQHKSPTKPDVLPSGH-KVDANSKILFCL 887 >At5g17650.1 68418.m02069 glycine/proline-rich protein glycine/proline-rich protein GPRP - Arabidopsis thaliana, EMBL:X84315 Length = 173 Score = 27.9 bits (59), Expect = 6.5 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = -3 Query: 378 HHDTCYRRHPDRTYEYHHHGHAEF 307 HH Y H Y Y +HGH +F Sbjct: 122 HHHGHYGHHHGHGYGYGYHGHGKF 145 >At5g55100.2 68418.m06869 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein contains Pfam domain PF01805: Surp module Length = 844 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/41 (29%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = -3 Query: 390 RTYVHHDTCYRRHPDRTY-EYHHHGHAEFGRQHVRYPMIRH 271 R++ H + +H D + E+HHH H R+H + H Sbjct: 735 RSHHHRSRKHEKHRDSSDDEHHHHRHRSSRRKHEDSSDVEH 775 >At5g55100.1 68418.m06868 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein contains Pfam domain PF01805: Surp module Length = 843 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/41 (29%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = -3 Query: 390 RTYVHHDTCYRRHPDRTY-EYHHHGHAEFGRQHVRYPMIRH 271 R++ H + +H D + E+HHH H R+H + H Sbjct: 735 RSHHHRSRKHEKHRDSSDDEHHHHRHRSSRRKHEDSSDVEH 775 >At1g80480.1 68414.m09427 PRLI-interacting factor L, putative similar to PRLI-interacting factor L [Arabidopsis thaliana] GI:11139268; contains Pfam profile PF02492: Cobalamin synthesis protein/P47K Length = 444 Score = 27.5 bits (58), Expect = 8.6 Identities = 9/28 (32%), Positives = 13/28 (46%) Frame = -3 Query: 378 HHDTCYRRHPDRTYEYHHHGHAEFGRQH 295 HHD + H D +++ HH H H Sbjct: 311 HHDHDHDHHHDHNHDHDHHHHDGHDHHH 338 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,841,460 Number of Sequences: 28952 Number of extensions: 318900 Number of successful extensions: 1060 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 981 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1049 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1428369392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -