BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060738.seq (673 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL023838-4|CAA19504.1| 218|Caenorhabditis elegans Hypothetical ... 30 1.3 Z75533-3|CAA99822.1| 868|Caenorhabditis elegans Hypothetical pr... 28 5.3 >AL023838-4|CAA19504.1| 218|Caenorhabditis elegans Hypothetical protein Y43C5A.4 protein. Length = 218 Score = 30.3 bits (65), Expect = 1.3 Identities = 14/26 (53%), Positives = 16/26 (61%) Frame = -3 Query: 377 NPKSDKAASPPGAPVHQYPVPVLPSP 300 +PK D +PPGAP VPV PSP Sbjct: 138 SPKKDDFFAPPGAPDPVPAVPVEPSP 163 >Z75533-3|CAA99822.1| 868|Caenorhabditis elegans Hypothetical protein C54G4.4 protein. Length = 868 Score = 28.3 bits (60), Expect = 5.3 Identities = 15/47 (31%), Positives = 26/47 (55%) Frame = -1 Query: 652 KTKSFHCCTSSCPHMLREIADRAM*RKLSPLRYYSGVQTGGSAHQCV 512 ++KSF + +R I+ R + K SP+ ++TGG+ HQC+ Sbjct: 249 ESKSFWEVDLLGDYSIRSISMR-LGTKSSPIVSVEAIETGGAVHQCI 294 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,178,206 Number of Sequences: 27780 Number of extensions: 328618 Number of successful extensions: 908 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 848 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 908 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1518563232 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -