BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060732.seq (456 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT003539-1|AAO39543.1| 373|Drosophila melanogaster RE05288p pro... 33 0.14 AE014298-3170|AAF50956.1| 373|Drosophila melanogaster CG14621-P... 33 0.14 >BT003539-1|AAO39543.1| 373|Drosophila melanogaster RE05288p protein. Length = 373 Score = 33.5 bits (73), Expect = 0.14 Identities = 16/41 (39%), Positives = 21/41 (51%) Frame = +1 Query: 205 LASCAHVXYVKFSQ*CRGKLALTELPXPLTMTAVQLCATXL 327 L C + S GK+ L E P P+T+T VQLC+ L Sbjct: 15 LLMCLFWYVISSSNNVIGKMVLNEFPFPMTVTLVQLCSITL 55 >AE014298-3170|AAF50956.1| 373|Drosophila melanogaster CG14621-PA protein. Length = 373 Score = 33.5 bits (73), Expect = 0.14 Identities = 16/41 (39%), Positives = 21/41 (51%) Frame = +1 Query: 205 LASCAHVXYVKFSQ*CRGKLALTELPXPLTMTAVQLCATXL 327 L C + S GK+ L E P P+T+T VQLC+ L Sbjct: 15 LLMCLFWYVISSSNNVIGKMVLNEFPFPMTVTLVQLCSITL 55 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,793,055 Number of Sequences: 53049 Number of extensions: 269588 Number of successful extensions: 424 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 421 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 424 length of database: 24,988,368 effective HSP length: 79 effective length of database: 20,797,497 effective search space used: 1497419784 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -