BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060732.seq (456 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 24 0.90 EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 22 2.7 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 21 4.8 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 23.8 bits (49), Expect = 0.90 Identities = 12/53 (22%), Positives = 23/53 (43%) Frame = +2 Query: 74 YGIIMNY*IKDLQ*FCDRNFALEYFLIKXKRNGYKXLQARDTNSWLPVRTWXM 232 Y + NY K+++ + D + L+YF+ + N Y W+ + M Sbjct: 200 YIVNTNYSSKNMREYNDPEYKLDYFMEDVELNAYYYYMREMLPYWMSSSQYHM 252 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 22.2 bits (45), Expect = 2.7 Identities = 12/53 (22%), Positives = 22/53 (41%) Frame = +2 Query: 74 YGIIMNY*IKDLQ*FCDRNFALEYFLIKXKRNGYKXLQARDTNSWLPVRTWXM 232 Y + NY K ++ + D + L+YF+ + N Y W+ + M Sbjct: 200 YIVNTNYSSKYMREYNDPEYKLDYFMEDVELNAYYYYMREMLPYWMSSSQYHM 252 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 21.4 bits (43), Expect = 4.8 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = +3 Query: 237 VQPVMSGQTGINRATXXTNYDSGT 308 ++ + SGQT + RA+ +GT Sbjct: 529 LEAIRSGQTSVQRASTEFGIPTGT 552 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 108,306 Number of Sequences: 438 Number of extensions: 1716 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 12066642 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -