BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060729.seq (674 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g44770.1 68418.m05487 DC1 domain-containing protein contains ... 28 5.0 At2g35260.1 68415.m04325 expressed protein 28 6.6 At4g23010.1 68417.m03319 UDP-galactose transporter-related conta... 27 8.7 At3g01880.1 68416.m00133 hypothetical protein 27 8.7 >At5g44770.1 68418.m05487 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 541 Score = 28.3 bits (60), Expect = 5.0 Identities = 17/49 (34%), Positives = 27/49 (55%) Frame = +1 Query: 313 LDDCFNVLSEKDNLGYFSIKIDFLKLFENHPDVGDRVLCAPIETLPICD 459 L+D F V++EK ++ +FS + L+L N+ D + C LPI D Sbjct: 244 LEDPFKVINEKGDIVHFSHEEHVLRLDVNYVHDNDTMCCGGC-ILPIND 291 >At2g35260.1 68415.m04325 expressed protein Length = 382 Score = 27.9 bits (59), Expect = 6.6 Identities = 14/44 (31%), Positives = 24/44 (54%) Frame = -1 Query: 137 TFFYGLSIWKFTIIFLIVLINRKLFAKFLFAEAHGLTDIIFESS 6 +FF+G+S W+F +I I +LF + A L+DI + + Sbjct: 194 SFFFGMSPWQFILIVAASSIGEELF--YRVAVQGALSDIFLKGT 235 >At4g23010.1 68417.m03319 UDP-galactose transporter-related contains weak similarity to UDP-galactose transporter related isozyme 1 (GI:1669562) [Mus musculus] Length = 345 Score = 27.5 bits (58), Expect = 8.7 Identities = 14/44 (31%), Positives = 26/44 (59%) Frame = -3 Query: 522 SKLYFKFLRFYNVLLGHHYIFIAYGQGFNGSTQNSVSHIRMVFK 391 ++L F F ++ + G Y+F+ Y QGF +T++ V+ +R K Sbjct: 46 NRLQFSFGWYFTFIQGFVYLFLIYLQGF--TTKHIVNPMRTYVK 87 >At3g01880.1 68416.m00133 hypothetical protein Length = 592 Score = 27.5 bits (58), Expect = 8.7 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +3 Query: 474 GPTTHYRI*GI*NTVSKLEYVFIKKNVHARFYGLP 578 GP HYRI N+V+K+ +F++K + +P Sbjct: 533 GPRVHYRIDIFLNSVAKILPIFLRKGLRKLINKIP 567 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,172,040 Number of Sequences: 28952 Number of extensions: 288380 Number of successful extensions: 512 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 507 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 512 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1432596384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -