BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060727.seq (685 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY534996-1|AAT07394.1| 471|Anopheles gambiae XK-related b protein. 24 5.1 AY553322-1|AAT36323.1| 426|Anopheles gambiae G-protein coupled ... 23 9.0 >AY534996-1|AAT07394.1| 471|Anopheles gambiae XK-related b protein. Length = 471 Score = 23.8 bits (49), Expect = 5.1 Identities = 11/43 (25%), Positives = 25/43 (58%), Gaps = 5/43 (11%) Frame = +2 Query: 359 IFYFLFRI-----KVLRTFLMSNLHYGYTFKIALLHCRSVYFW 472 IF FL+R+ +V+ + ++++ + F + +LH S++ W Sbjct: 352 IFQFLWRLGTVISRVISLTVYASVYSHWVFLVIILHWFSMFLW 394 >AY553322-1|AAT36323.1| 426|Anopheles gambiae G-protein coupled receptor 4 protein. Length = 426 Score = 23.0 bits (47), Expect = 9.0 Identities = 14/54 (25%), Positives = 22/54 (40%) Frame = +1 Query: 520 HVSVVICSLYTLMELFLNYYL*NSFEKY*MHQIFLLRWXLRISARIARSLLCEG 681 H V C ++ M F Y N + + F + + LR+SA R + G Sbjct: 144 HAGNVACKVFLFMRAFCLYLSSNVLVCVSLDRCFAVIYPLRVSAARKRGKIMLG 197 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 621,958 Number of Sequences: 2352 Number of extensions: 11574 Number of successful extensions: 18 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68995575 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -