BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060727.seq (685 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC024882-2|AAF60935.2| 344|Caenorhabditis elegans Seven tm rece... 29 4.1 Z75554-11|CAA99961.1| 301|Caenorhabditis elegans Hypothetical p... 28 5.4 >AC024882-2|AAF60935.2| 344|Caenorhabditis elegans Seven tm receptor protein 156 protein. Length = 344 Score = 28.7 bits (61), Expect = 4.1 Identities = 19/67 (28%), Positives = 33/67 (49%) Frame = +2 Query: 284 LKYDSGFHVLFFISIIAIRHSSTRFIFYFLFRIKVLRTFLMSNLHYGYTFKIALLHCRSV 463 L+Y SGF ++F+I + + T F+FY + + + L NL Y I +++ Sbjct: 126 LRYFSGFRLVFWILLSILCGIMTGFMFYAIGSRQEISQGLRENLETMYDLDIN----QTI 181 Query: 464 YFW*LKW 484 Y+ L W Sbjct: 182 YYVFLYW 188 >Z75554-11|CAA99961.1| 301|Caenorhabditis elegans Hypothetical protein ZC455.8a protein. Length = 301 Score = 28.3 bits (60), Expect = 5.4 Identities = 13/46 (28%), Positives = 24/46 (52%) Frame = +2 Query: 269 FQNHILKYDSGFHVLFFISIIAIRHSSTRFIFYFLFRIKVLRTFLM 406 FQN ++K +H+ I+ I +S T I+YF + + F++ Sbjct: 34 FQNSLMKNKPEYHLFKIRFIVDICYSLTVSIYYFSLIVSYISPFIL 79 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,626,064 Number of Sequences: 27780 Number of extensions: 263695 Number of successful extensions: 591 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 569 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 591 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1560745544 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -