BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060724.seq (516 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. 27 0.50 AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. 25 1.5 DQ974164-1|ABJ52804.1| 410|Anopheles gambiae serpin 4C protein. 24 3.5 AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcript... 23 4.6 AY334004-1|AAR01129.1| 194|Anopheles gambiae integrin protein. 23 6.1 AY334003-1|AAR01128.1| 194|Anopheles gambiae integrin protein. 23 6.1 AY334002-1|AAR01127.1| 194|Anopheles gambiae integrin protein. 23 6.1 AY334001-1|AAR01126.1| 194|Anopheles gambiae integrin protein. 23 6.1 AJ130951-1|CAA10260.1| 189|Anopheles gambiae SG3 protein protein. 23 6.1 AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin s... 23 6.1 Z22930-3|CAA80515.1| 275|Anopheles gambiae trypsin protein. 23 8.1 AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcrip... 23 8.1 >M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. Length = 1212 Score = 26.6 bits (56), Expect = 0.50 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +1 Query: 322 RQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPP 423 R++ +R +E +L EA A + N + QP PP Sbjct: 1101 REEDERRTEERRQLHNEANRAYRQRNRRSQPTPP 1134 >AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. Length = 1132 Score = 25.0 bits (52), Expect = 1.5 Identities = 18/68 (26%), Positives = 31/68 (45%) Frame = +1 Query: 307 KHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAAHIVSGTEKPVLLAPIPYE 486 KH C + +E +++ KEA +T+NL + +A + GT + V + Y Sbjct: 323 KHRLCELNREPTEREEQQMQKEAAVMARTMNLNQVCLCFRAYRVEPGTGRWVPICEPVYS 382 Query: 487 FVA*SPIN 510 +PIN Sbjct: 383 ----NPIN 386 >DQ974164-1|ABJ52804.1| 410|Anopheles gambiae serpin 4C protein. Length = 410 Score = 23.8 bits (49), Expect = 3.5 Identities = 11/36 (30%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = +2 Query: 179 HKVYHGKTGRVYN-VTAHALGVIVNKLFAEGLYRSA 283 H HG+ + + ++A + +IVN L+ GL+ A Sbjct: 92 HNQTHGRIADIVSHISADTILMIVNTLYFRGLWEEA 127 >AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcriptase protein. Length = 1022 Score = 23.4 bits (48), Expect = 4.6 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -1 Query: 162 TAPLPLMSTMSPTLYTFMYVE 100 TA +P S + PTL+ MY E Sbjct: 607 TAGVPQGSVLGPTLWNLMYNE 627 >AY334004-1|AAR01129.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 23.0 bits (47), Expect = 6.1 Identities = 6/14 (42%), Positives = 9/14 (64%) Frame = +1 Query: 223 CSCSRCDCQQAVRG 264 C+C RC C ++ G Sbjct: 42 CNCGRCSCDESFFG 55 >AY334003-1|AAR01128.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 23.0 bits (47), Expect = 6.1 Identities = 6/14 (42%), Positives = 9/14 (64%) Frame = +1 Query: 223 CSCSRCDCQQAVRG 264 C+C RC C ++ G Sbjct: 42 CNCGRCSCDESFFG 55 >AY334002-1|AAR01127.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 23.0 bits (47), Expect = 6.1 Identities = 6/14 (42%), Positives = 9/14 (64%) Frame = +1 Query: 223 CSCSRCDCQQAVRG 264 C+C RC C ++ G Sbjct: 42 CNCGRCSCDESFFG 55 >AY334001-1|AAR01126.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 23.0 bits (47), Expect = 6.1 Identities = 6/14 (42%), Positives = 9/14 (64%) Frame = +1 Query: 223 CSCSRCDCQQAVRG 264 C+C RC C ++ G Sbjct: 42 CNCGRCSCDESFFG 55 >AJ130951-1|CAA10260.1| 189|Anopheles gambiae SG3 protein protein. Length = 189 Score = 23.0 bits (47), Expect = 6.1 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = -1 Query: 222 VTLYTRPVFPWYTLCGIP 169 V ++ RP PW+++ GIP Sbjct: 73 VGIFGRPGRPWWSVPGIP 90 >AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin subunit AgBnu protein. Length = 803 Score = 23.0 bits (47), Expect = 6.1 Identities = 6/14 (42%), Positives = 9/14 (64%) Frame = +1 Query: 223 CSCSRCDCQQAVRG 264 C+C RC C ++ G Sbjct: 618 CNCGRCSCDESFFG 631 >Z22930-3|CAA80515.1| 275|Anopheles gambiae trypsin protein. Length = 275 Score = 22.6 bits (46), Expect = 8.1 Identities = 8/26 (30%), Positives = 15/26 (57%) Frame = -2 Query: 299 STRILMRFGIILPRTAC*QSHREHEQ 222 S +I + ++L AC Q+H H++ Sbjct: 2 SNKITILLAVLLAVVACAQAHASHQR 27 >AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcription factor protein. Length = 593 Score = 22.6 bits (46), Expect = 8.1 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +1 Query: 73 VPHTWNYSALHVHESVQS 126 V +TWNY+A V + V S Sbjct: 282 VENTWNYTAADVADLVDS 299 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 547,004 Number of Sequences: 2352 Number of extensions: 11207 Number of successful extensions: 32 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46937349 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -