BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060723.seq (494 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z92849-6|CAB07429.2| 306|Caenorhabditis elegans Hypothetical pr... 27 9.9 AC024838-6|AAF60823.1| 214|Caenorhabditis elegans Hypothetical ... 27 9.9 >Z92849-6|CAB07429.2| 306|Caenorhabditis elegans Hypothetical protein H12D21.7 protein. Length = 306 Score = 26.6 bits (56), Expect = 9.9 Identities = 13/36 (36%), Positives = 16/36 (44%) Frame = -3 Query: 180 IHSTYAPLLRRSLSQHKLKIRGYHEYLYSNNDFKQY 73 I +TYAP R + K K G + L NN Y Sbjct: 22 IDATYAPTATRDYKEFKTKCYGNFDLLTKNNTVAAY 57 >AC024838-6|AAF60823.1| 214|Caenorhabditis elegans Hypothetical protein Y59E9AL.6 protein. Length = 214 Score = 26.6 bits (56), Expect = 9.9 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -3 Query: 261 IILPCGGXKKAPDPHS 214 I++ CGG KKAP P S Sbjct: 20 ILIGCGGKKKAPPPKS 35 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,322,876 Number of Sequences: 27780 Number of extensions: 198431 Number of successful extensions: 441 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 422 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 441 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 935344784 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -