BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060718.seq (472 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 23 2.2 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 22 2.9 AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly pro... 21 8.8 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 22.6 bits (46), Expect = 2.2 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = -1 Query: 331 YHHHGHAEFGRQHVQY 284 +HHH H QH+ Y Sbjct: 351 HHHHHHQTQSLQHLHY 366 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 22.2 bits (45), Expect = 2.9 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +1 Query: 343 GQGAFGNMCRGXRMFAP 393 G G FG++CRG P Sbjct: 640 GGGEFGDVCRGKLKLPP 656 >AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly protein MRJP5 protein. Length = 598 Score = 20.6 bits (41), Expect = 8.8 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = -1 Query: 313 AEFGRQHVQYPMIQHWFGDHLLAHAVGLPRVL 218 +E+G +VQY +Q F +A + VL Sbjct: 287 SEYGANNVQYQGVQDIFNTESIAKIMSKNGVL 318 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 114,418 Number of Sequences: 438 Number of extensions: 2159 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 12682287 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -