BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060717.seq (641 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF243042-1|AAF68438.1| 126|Tribolium castaneum mutant transcrip... 26 0.23 AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 23 1.6 U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. 21 6.5 U81038-1|AAB39355.1| 412|Tribolium castaneum transcription fact... 21 6.5 AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory recept... 21 6.5 AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. 21 6.5 X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 21 8.6 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 21 8.6 >AF243042-1|AAF68438.1| 126|Tribolium castaneum mutant transcription factor TcDfd1 protein. Length = 126 Score = 26.2 bits (55), Expect = 0.23 Identities = 13/45 (28%), Positives = 19/45 (42%) Frame = -3 Query: 468 LETVYDMISLFQPELHQEVGPKFHTDQSLTSHNQTVRPCMPEIQV 334 L Y + + P+LH GP H + T C P++QV Sbjct: 75 LSNGYGYGNYYHPQLHSHHGPPIHHQIRPPILHDTQPMCNPQLQV 119 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 23.4 bits (48), Expect = 1.6 Identities = 15/64 (23%), Positives = 26/64 (40%) Frame = -3 Query: 456 YDMISLFQPELHQEVGPKFHTDQSLTSHNQTVRPCMPEIQVAPIQIL*QVSQRNFSRFCK 277 YD + P H++ FH + T N T + +++ +L Q Q + FC Sbjct: 432 YDFYKMNHPVYHKDPHYGFHNVTNTTLQNLTPQLNYISMKLQSFPLLSQRHQIDAKMFCN 491 Query: 276 AAIV 265 + V Sbjct: 492 ESSV 495 >U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. Length = 283 Score = 21.4 bits (43), Expect = 6.5 Identities = 8/24 (33%), Positives = 11/24 (45%) Frame = -3 Query: 468 LETVYDMISLFQPELHQEVGPKFH 397 L Y + + P+LH GP H Sbjct: 75 LSNGYGYGNYYHPQLHSHHGPPIH 98 >U81038-1|AAB39355.1| 412|Tribolium castaneum transcription factor Deformed protein. Length = 412 Score = 21.4 bits (43), Expect = 6.5 Identities = 8/24 (33%), Positives = 11/24 (45%) Frame = -3 Query: 468 LETVYDMISLFQPELHQEVGPKFH 397 L Y + + P+LH GP H Sbjct: 75 LSNGYGYGNYYHPQLHSHHGPPIH 98 >AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory receptor candidate 23 protein. Length = 291 Score = 21.4 bits (43), Expect = 6.5 Identities = 12/34 (35%), Positives = 14/34 (41%) Frame = +1 Query: 397 MKFWAYLLVQLRLK*RNHIVNSL*FCILTKKLVT 498 M+ W YLL L N L C L +VT Sbjct: 36 MRSWYYLLTNLTYNNTNRKYYWLNVCCLNLSIVT 69 >AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. Length = 412 Score = 21.4 bits (43), Expect = 6.5 Identities = 8/24 (33%), Positives = 11/24 (45%) Frame = -3 Query: 468 LETVYDMISLFQPELHQEVGPKFH 397 L Y + + P+LH GP H Sbjct: 75 LSNGYGYGNYYHPQLHSHHGPPIH 98 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 21.0 bits (42), Expect = 8.6 Identities = 6/14 (42%), Positives = 9/14 (64%) Frame = -1 Query: 602 LMLQVHQGYHXFPN 561 ++ +H GYH F N Sbjct: 484 VLYTIHMGYHGFHN 497 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 21.0 bits (42), Expect = 8.6 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +2 Query: 218 PKDVSVQIVLANTN 259 PK+ + QI+LAN N Sbjct: 1596 PKEDTFQIILANLN 1609 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 154,580 Number of Sequences: 336 Number of extensions: 3346 Number of successful extensions: 11 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16448590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -