BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060717.seq (641 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0283 + 13887388-13887573,13887711-13887806,13888517-138886... 72 4e-13 04_04_0712 + 27476319-27476569,27477150-27477402,27477535-274779... 51 7e-07 02_01_0717 + 5351504-5351602,5353401-5353499,5353574-5353675,535... 50 2e-06 02_05_0183 + 26537676-26537752,26538481-26538649,26538736-265389... 47 1e-05 02_05_0699 + 31013176-31013345,31013749-31013872,31013950-310140... 46 3e-05 05_01_0411 + 3243025-3243092,3243348-3243496,3243740-3243872,324... 45 4e-05 03_06_0226 + 32495088-32495237,32496189-32496351,32496438-324965... 45 4e-05 03_05_0497 + 24932336-24932485,24934037-24934199,24934306-249344... 45 4e-05 08_02_1300 + 25972496-25972582,25972664-25972723,25973786-259738... 45 6e-05 06_01_0929 - 7171395-7171676,7172019-7172219,7172438-7172524,717... 44 8e-05 03_02_0650 + 10174905-10175000,10175321-10175376,10175467-101755... 44 1e-04 08_01_0408 - 3616655-3617108,3617190-3617596,3618120-3618287 43 2e-04 06_03_0949 - 26262993-26263130,26263602-26263670,26263809-26264030 42 3e-04 06_01_0120 - 926226-926289,926821-926887,927122-927170,927257-92... 42 3e-04 12_02_1140 + 26411424-26411998,26412491-26412761,26412848-26413405 42 6e-04 09_04_0594 - 18831011-18831360,18831562-18832111,18832364-188334... 42 6e-04 02_02_0600 + 12018256-12018502,12018943-12019073,12019104-12019553 41 7e-04 01_05_0327 + 20984336-20985478 40 0.001 06_03_1400 + 29901835-29902136,29902913-29902934 40 0.002 05_01_0207 + 1493224-1493385,1493475-1493839,1494313-1494390,149... 40 0.002 02_03_0378 + 18327622-18329826 40 0.002 05_07_0111 - 27752339-27752777,27753356-27753840,27753956-27754120 40 0.002 12_02_0454 + 19199063-19200757,19202201-19202287 39 0.003 05_04_0027 - 17298727-17299830 39 0.003 04_03_0735 + 19141038-19143227 39 0.003 02_01_0713 - 5332145-5332351,5332675-5332893,5334347-5334559,533... 39 0.004 08_02_0469 - 17531189-17531678,17531773-17531798,17533511-17533669 38 0.005 01_01_1190 + 9463973-9465732,9466210-9466440,9467664-9467793,946... 38 0.005 03_01_0260 - 1999462-1999488,1999748-1999930,2000940-2001146,200... 38 0.007 01_07_0380 + 43181564-43181639,43182053-43182218,43182494-431826... 38 0.007 01_05_0646 + 23907837-23907956,23908077-23908164,23908282-239083... 38 0.007 02_04_0220 - 21014225-21014386,21014492-21014572,21014739-210149... 38 0.009 06_03_0339 - 19687749-19690805 37 0.012 08_02_0992 + 23380855-23381195,23382464-23382506,23383306-233833... 37 0.016 06_01_0806 - 6048042-6048138,6048461-6048550,6049362-6049425,604... 37 0.016 03_02_0438 + 8470290-8470378,8470900-8470990,8471074-8471134,847... 37 0.016 01_06_0406 + 29113033-29113119,29113250-29113309,29114104-291141... 37 0.016 01_01_1212 + 9763949-9764412,9765183-9765252,9765356-9765457 37 0.016 12_02_1085 - 25935688-25935948,25936589-25936657,25937244-259373... 36 0.021 01_01_0976 + 7711634-7711801,7712741-7713183,7715813-7716251 36 0.021 05_06_0267 - 26784861-26784896,26785324-26785404,26785530-267857... 36 0.027 02_05_0381 - 28483425-28483458,28483588-28483658,28483746-284838... 36 0.036 08_02_1491 + 27500532-27500972 35 0.048 06_01_0667 + 4878784-4878900,4879016-4879118,4879256-4879341,487... 35 0.048 11_06_0179 + 20952070-20955228 35 0.063 03_06_0554 + 34691050-34691242,34691327-34691394,34691754-34692275 34 0.083 02_05_0821 - 32019775-32019882,32020296-32020352,32020614-320206... 34 0.083 02_01_0225 - 1469295-1469733,1472352-1472767,1473603-1473658,147... 34 0.083 10_08_0580 - 18912364-18912420,18912524-18912631,18912973-189132... 34 0.11 07_03_1296 + 25583195-25584385 34 0.11 03_03_0278 - 16126803-16129049 34 0.11 01_05_0147 + 18597194-18597643,18598347-18598681,18600073-186001... 34 0.11 05_06_0167 - 26104527-26104567,26105130-26105226,26105377-261054... 33 0.15 05_03_0564 - 15502458-15503303,15503394-15503474,15503572-155036... 33 0.15 05_03_0563 - 15493570-15494415,15494506-15494586,15494684-154947... 33 0.15 05_03_0562 - 15484733-15485578,15485669-15485749,15485847-154858... 33 0.15 01_05_0090 + 18038219-18038421,18039365-18039488,18040229-180403... 33 0.15 03_06_0568 - 34778408-34778710,34779340-34779411,34779549-347796... 33 0.19 01_06_0592 + 30465956-30466210,30466401-30466529,30466631-304667... 33 0.19 01_01_1211 + 9753518-9753894,9754265-9754313,9754747-9754773 33 0.19 03_06_0049 + 31282563-31282841,31283052-31283903,31284109-312841... 33 0.25 12_01_0438 + 3455686-3455692,3456149-3456240,3457422-3457505,345... 32 0.34 05_07_0247 + 28643862-28644310,28645151-28645207,28645644-286489... 32 0.34 03_05_0019 + 19862171-19863049 32 0.34 01_07_0010 + 40429613-40429677,40429702-40430015,40432150-40434386 32 0.34 01_04_0054 - 15456668-15459691 32 0.45 01_03_0254 - 14276308-14276313,14277101-14277277,14278290-14278688 32 0.45 11_06_0632 + 25674807-25675477,25676472-25677861,25677948-256780... 31 0.59 09_04_0406 + 17340129-17340650 31 0.59 08_02_0878 + 22152437-22152532,22152619-22152718,22152907-221529... 31 0.59 04_04_1571 + 34504087-34504421,34505002-34505731,34506091-345120... 31 0.59 03_02_0727 - 10742899-10744375,10744470-10744933,10745412-10745477 31 0.59 01_05_0808 - 25414486-25414677,25415114-25415290,25415839-254159... 31 0.59 11_08_0055 - 28095996-28096934 31 0.78 12_02_0693 - 22207582-22207620,22208421-22208597,22209258-222093... 31 1.0 03_02_0704 - 10542187-10542339,10542466-10542522,10542667-105427... 30 1.4 01_01_0013 + 81507-81932,82718-82864 30 1.8 07_03_1759 + 29285262-29287208 29 2.4 12_01_0915 - 8908643-8908756,8909086-8909203,8909570-8909682,891... 29 3.1 03_06_0601 + 34991912-34992352,34993719-34994516 29 3.1 03_06_0599 + 34984869-34985319,34986581-34987563 29 3.1 02_01_0383 + 2776526-2776632,2777579-2777835,2777915-2778366,277... 29 3.1 07_03_1417 + 26418131-26418178,26418410-26418502,26418861-264188... 29 4.1 07_01_0042 - 334417-334431,334563-334688,334852-335136,335220-33... 29 4.1 03_02_0030 + 5129234-5129568,5130020-5130651,5130936-5131243,513... 29 4.1 11_01_0725 - 5987706-5988126,5988610-5988902 28 5.5 06_03_0151 + 17270688-17270698,17271149-17271281,17271548-172715... 28 5.5 03_02_0205 + 6389343-6389609,6390418-6390486,6390662-6390757,639... 28 5.5 12_02_0488 + 19587337-19587648,19587739-19587798,19587876-195879... 27 9.6 10_08_1023 - 22341815-22342042,22342179-22342247,22342717-223428... 27 9.6 10_08_0184 - 15570471-15570684,15571085-15571354,15571489-155717... 27 9.6 09_06_0281 + 22014394-22015534,22016041-22017056 27 9.6 09_04_0165 + 15274448-15277336 27 9.6 07_01_0069 + 505291-505327,505726-505956,506317-506652,507025-50... 27 9.6 03_02_0845 - 11700830-11701327 27 9.6 >04_03_0283 + 13887388-13887573,13887711-13887806,13888517-13888637, 13888734-13888840,13888949-13889166,13890219-13890396, 13890492-13890611,13891601-13891687,13892401-13892511, 13892618-13893439 Length = 681 Score = 71.7 bits (168), Expect = 4e-13 Identities = 33/76 (43%), Positives = 47/76 (61%), Gaps = 2/76 (2%) Frame = +3 Query: 279 YKSVKNFFV--KLAIVSGWVLLGFLAYKVSQFDYEMSNFDPYEILGLPPGATQAEIKKSY 452 YK + NF L I+ W+++ FL Y + E+ F+PY ILGL PGA++++IKKSY Sbjct: 60 YKRISNFSTCSNLTILLLWIVMIFLVYYIKHVSREVQVFEPYSILGLEPGASESDIKKSY 119 Query: 453 RKQSLVLHPDKETGDE 500 R+ S+ HPDK E Sbjct: 120 RRLSIQYHPDKNPDPE 135 Score = 40.7 bits (91), Expect = 0.001 Identities = 16/25 (64%), Positives = 21/25 (84%) Frame = +2 Query: 515 LTKAYQALTDDEARRNWEXYGNPDG 589 ++KAYQALTD +R N+E YG+PDG Sbjct: 144 ISKAYQALTDPVSRENYEKYGHPDG 168 >04_04_0712 + 27476319-27476569,27477150-27477402,27477535-27477914, 27479738-27479864,27479945-27480110,27480221-27480359, 27481854-27481987,27482087-27482229,27482367-27482565, 27482688-27483010 Length = 704 Score = 51.2 bits (117), Expect = 7e-07 Identities = 27/65 (41%), Positives = 38/65 (58%) Frame = +3 Query: 366 FDYEMSNFDPYEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEKAL*GSQRHTRLLQM 545 F E +N YE+LG+P A++ E+KK+YRK ++ HPDK EK SQ + L Sbjct: 292 FGMESNNTKYYEVLGVPKTASKDELKKAYRKAAIKNHPDKGGDPEKFKELSQAYEVLTDP 351 Query: 546 MKRDV 560 KRD+ Sbjct: 352 EKRDI 356 Score = 28.7 bits (61), Expect = 4.1 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 Query: 500 EGFMRLTKAYQALTDDEARRNWEXYG 577 E F L++AY+ LTD E R ++ YG Sbjct: 336 EKFKELSQAYEVLTDPEKRDIYDQYG 361 >02_01_0717 + 5351504-5351602,5353401-5353499,5353574-5353675, 5353756-5353815,5353900-5354006,5354114-5354196, 5354372-5354462,5354561-5354768 Length = 282 Score = 50.0 bits (114), Expect = 2e-06 Identities = 23/37 (62%), Positives = 28/37 (75%) Frame = +3 Query: 396 YEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEKA 506 YEILG+ A+Q EIKK+Y K +L LHPDK GDE+A Sbjct: 32 YEILGVERTASQQEIKKAYHKLALRLHPDKNPGDEEA 68 >02_05_0183 + 26537676-26537752,26538481-26538649,26538736-26538910, 26539008-26539137,26540425-26540558,26540629-26540771, 26540894-26541092,26541183-26541514 Length = 452 Score = 46.8 bits (106), Expect = 1e-05 Identities = 26/73 (35%), Positives = 40/73 (54%) Frame = +3 Query: 342 FLAYKVSQFDYEMSNFDPYEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEKAL*GSQ 521 FL+ + + +N YE+LG+ ATQ E+KK+YRK ++ HPDK EK +Q Sbjct: 29 FLSVMYGRMPKKSNNTKYYEVLGVSKTATQDELKKAYRKAAIKNHPDKGGDPEKFKELAQ 88 Query: 522 RHTRLLQMMKRDV 560 + L KR++ Sbjct: 89 AYEVLNDPEKREI 101 >02_05_0699 + 31013176-31013345,31013749-31013872,31013950-31014032, 31014106-31014217,31014297-31014401,31014809-31014859, 31015893-31015979,31016325-31016402,31016477-31016530, 31016608-31016892 Length = 382 Score = 46.0 bits (104), Expect = 3e-05 Identities = 19/39 (48%), Positives = 26/39 (66%) Frame = +3 Query: 390 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEKA 506 DPYE+LG+ AT+ EIK ++R+ +L HPDK D A Sbjct: 31 DPYEVLGVGRNATEQEIKSAFRRMALKYHPDKNADDPVA 69 >05_01_0411 + 3243025-3243092,3243348-3243496,3243740-3243872, 3244740-3244860,3245065-3245181,3245303-3245389, 3245941-3246000,3246097-3246174,3246587-3246658, 3246767-3246925 Length = 347 Score = 45.2 bits (102), Expect = 4e-05 Identities = 18/37 (48%), Positives = 28/37 (75%) Frame = +3 Query: 396 YEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEKA 506 Y++L +P GA++ +IK+SYRK +L HPDK +E+A Sbjct: 27 YDVLQVPKGASEDQIKRSYRKLALKYHPDKNPNNEEA 63 Score = 27.5 bits (58), Expect = 9.6 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +2 Query: 506 FMRLTKAYQALTDDEARRNWEXYG 577 F + AY+ LTD E R+ ++ YG Sbjct: 67 FAEINNAYEILTDQEKRKIYDRYG 90 >03_06_0226 + 32495088-32495237,32496189-32496351,32496438-32496576, 32496669-32496945,32497051-32497249,32497379-32497704 Length = 417 Score = 45.2 bits (102), Expect = 4e-05 Identities = 22/55 (40%), Positives = 34/55 (61%) Frame = +3 Query: 396 YEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEKAL*GSQRHTRLLQMMKRDV 560 YE+LG+P A+Q ++KK+YRK ++ HPDK EK +Q + L KR++ Sbjct: 15 YEVLGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEVLSDPEKREI 69 Score = 27.5 bits (58), Expect = 9.6 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +2 Query: 500 EGFMRLTKAYQALTDDEARRNWEXYG 577 E F L +AY+ L+D E R ++ YG Sbjct: 49 EKFKELAQAYEVLSDPEKREIYDQYG 74 >03_05_0497 + 24932336-24932485,24934037-24934199,24934306-24934447, 24934528-24934804,24934887-24935085,24935169-24935491 Length = 417 Score = 45.2 bits (102), Expect = 4e-05 Identities = 23/55 (41%), Positives = 34/55 (61%) Frame = +3 Query: 396 YEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEKAL*GSQRHTRLLQMMKRDV 560 YEILG+P A+Q ++KK+YRK ++ HPDK EK +Q + L KR++ Sbjct: 15 YEILGVPKTASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEVLSDPEKREI 69 Score = 27.5 bits (58), Expect = 9.6 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +2 Query: 500 EGFMRLTKAYQALTDDEARRNWEXYG 577 E F L +AY+ L+D E R ++ YG Sbjct: 49 EKFKELAQAYEVLSDPEKREIYDQYG 74 >08_02_1300 + 25972496-25972582,25972664-25972723,25973786-25973868, 25974120-25974166,25975194-25975352,25975466-25975644, 25975738-25975818,25975903-25976046,25976246-25976347 Length = 313 Score = 44.8 bits (101), Expect = 6e-05 Identities = 18/37 (48%), Positives = 27/37 (72%) Frame = +3 Query: 396 YEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEKA 506 Y++LG+ P AT++EIKK+Y ++ +HPDK D KA Sbjct: 8 YDVLGVSPTATESEIKKAYYMKARQVHPDKNPNDPKA 44 >06_01_0929 - 7171395-7171676,7172019-7172219,7172438-7172524, 7172973-7173023,7173883-7173987,7174074-7174185, 7174284-7174366,7174434-7174557,7174822-7174973 Length = 398 Score = 44.4 bits (100), Expect = 8e-05 Identities = 19/39 (48%), Positives = 25/39 (64%) Frame = +3 Query: 390 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEKA 506 DPYE+LG+ AT EIK ++R+ +L HPDK D A Sbjct: 25 DPYEVLGVGRNATDQEIKSAFRRMALKYHPDKNGDDPVA 63 >03_02_0650 + 10174905-10175000,10175321-10175376,10175467-10175540, 10176215-10176753,10176845-10177186,10177520-10177879, 10177982-10178193,10178881-10179169,10179469-10180152 Length = 883 Score = 43.6 bits (98), Expect = 1e-04 Identities = 17/34 (50%), Positives = 25/34 (73%) Frame = +3 Query: 384 NFDPYEILGLPPGATQAEIKKSYRKQSLVLHPDK 485 N DPY++LG+ A+Q +I+K++ K SL HPDK Sbjct: 27 NLDPYKVLGVDKSASQRDIQKAFHKLSLKYHPDK 60 Score = 33.9 bits (74), Expect = 0.11 Identities = 14/34 (41%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Frame = +2 Query: 497 REGFMRLTKAYQALTDDEARRNWEXYGNPDG-PG 595 +E F + AY L+D+E R+N++ YG+ G PG Sbjct: 67 QEKFAEINNAYDILSDEEKRKNYDLYGDEKGNPG 100 >08_01_0408 - 3616655-3617108,3617190-3617596,3618120-3618287 Length = 342 Score = 42.7 bits (96), Expect = 2e-04 Identities = 17/38 (44%), Positives = 26/38 (68%) Frame = +3 Query: 390 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEK 503 D Y +L + AT+ ++KKSYR+ ++ HPDK GD+K Sbjct: 4 DYYNVLKVNRNATEEDLKKSYRRMAMKWHPDKNPGDKK 41 >06_03_0949 - 26262993-26263130,26263602-26263670,26263809-26264030 Length = 142 Score = 42.3 bits (95), Expect = 3e-04 Identities = 16/31 (51%), Positives = 23/31 (74%) Frame = +3 Query: 390 DPYEILGLPPGATQAEIKKSYRKQSLVLHPD 482 D Y L LPPGAT+ E+K+++R+ +L HPD Sbjct: 48 DHYRTLRLPPGATKGEVKRAFRRLALTYHPD 78 >06_01_0120 - 926226-926289,926821-926887,927122-927170,927257-927313, 927826-927897,928145-928236,928331-928403,928870-928944, 929207-929314,929372-929422,929834-929959,930324-930362, 930452-930535,931018-931109,931217-931300,931410-931524 Length = 415 Score = 42.3 bits (95), Expect = 3e-04 Identities = 22/56 (39%), Positives = 30/56 (53%) Frame = +3 Query: 390 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEKAL*GSQRHTRLLQMMKRD 557 D Y++LG+ A+Q EIKK+Y + LHPD GD A Q R + +K D Sbjct: 75 DYYDVLGVSRNASQGEIKKAYYALAKKLHPDTNKGDSDAERKFQEVQRAYETLKDD 130 >12_02_1140 + 26411424-26411998,26412491-26412761,26412848-26413405 Length = 467 Score = 41.5 bits (93), Expect = 6e-04 Identities = 18/37 (48%), Positives = 28/37 (75%) Frame = +3 Query: 396 YEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEKA 506 Y++LG+P GA EI+++YR+ ++ HPDK GDE+A Sbjct: 14 YDLLGVPRGADGDEIRRAYRRAAVTHHPDK-GGDEEA 49 >09_04_0594 - 18831011-18831360,18831562-18832111,18832364-18833406, 18833496-18833760,18835194-18835340,18835431-18835511, 18835626-18835804,18835935-18836093,18836269-18836398, 18836935-18837094,18837337-18837419,18837865-18837915, 18838035-18838151,18838273-18838359 Length = 1133 Score = 41.5 bits (93), Expect = 6e-04 Identities = 17/37 (45%), Positives = 25/37 (67%) Frame = +3 Query: 396 YEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEKA 506 Y++LG+ P AT+ EIKK+Y ++ +HPDK D A Sbjct: 8 YDVLGVSPTATEVEIKKAYYMKARKVHPDKNPNDPLA 44 >02_02_0600 + 12018256-12018502,12018943-12019073,12019104-12019553 Length = 275 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/38 (44%), Positives = 26/38 (68%) Frame = +3 Query: 390 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEK 503 D Y++L + GAT+ E+KK+YRK ++ HPDK +K Sbjct: 4 DYYKLLQVERGATEEELKKAYRKLAMKWHPDKNPNSKK 41 >01_05_0327 + 20984336-20985478 Length = 380 Score = 40.3 bits (90), Expect = 0.001 Identities = 17/32 (53%), Positives = 23/32 (71%) Frame = +3 Query: 390 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDK 485 D Y+ILGL T +++K+YRK SL +HPDK Sbjct: 130 DYYQILGLEKDCTVEDVRKAYRKLSLKVHPDK 161 >06_03_1400 + 29901835-29902136,29902913-29902934 Length = 107 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/36 (50%), Positives = 26/36 (72%), Gaps = 1/36 (2%) Frame = +3 Query: 396 YEILGLPPGATQAEIKKSYRKQSLVLHPDK-ETGDE 500 YE+LG+ GA++ EIK +YR+ + +HPD TGDE Sbjct: 46 YEVLGVGAGASRGEIKAAYRRLAREVHPDAGATGDE 81 >05_01_0207 + 1493224-1493385,1493475-1493839,1494313-1494390, 1496134-1496157,1496213-1496654 Length = 356 Score = 39.9 bits (89), Expect = 0.002 Identities = 16/32 (50%), Positives = 24/32 (75%) Frame = +3 Query: 390 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDK 485 D Y++LG+ GAT E+K+SYR+ ++ HPDK Sbjct: 4 DYYKVLGVGRGATDEELKRSYRRLAMKHHPDK 35 >02_03_0378 + 18327622-18329826 Length = 734 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/32 (56%), Positives = 21/32 (65%) Frame = +3 Query: 390 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDK 485 D Y IL L A + E+KK YRK +L LHPDK Sbjct: 72 DWYRILSLSASADEEEVKKQYRKLALQLHPDK 103 >05_07_0111 - 27752339-27752777,27753356-27753840,27753956-27754120 Length = 362 Score = 39.5 bits (88), Expect = 0.002 Identities = 16/38 (42%), Positives = 26/38 (68%) Frame = +3 Query: 390 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEK 503 D Y+ILG+ A+ ++KK+YRK ++ HPDK ++K Sbjct: 4 DYYKILGVDKAASDDDLKKAYRKLAMKWHPDKNPNNKK 41 >12_02_0454 + 19199063-19200757,19202201-19202287 Length = 593 Score = 39.1 bits (87), Expect = 0.003 Identities = 15/31 (48%), Positives = 24/31 (77%) Frame = +3 Query: 396 YEILGLPPGATQAEIKKSYRKQSLVLHPDKE 488 YE+LG+P + A+IK ++R+ +L LHPDK+ Sbjct: 12 YEVLGVPRDCSPADIKLAFRRLALSLHPDKQ 42 >05_04_0027 - 17298727-17299830 Length = 367 Score = 39.1 bits (87), Expect = 0.003 Identities = 18/34 (52%), Positives = 23/34 (67%) Frame = +3 Query: 384 NFDPYEILGLPPGATQAEIKKSYRKQSLVLHPDK 485 N D Y ILG+ + EI+K+YRK SL +HPDK Sbjct: 104 NKDYYAILGVERSCSVEEIRKAYRKLSLKVHPDK 137 >04_03_0735 + 19141038-19143227 Length = 729 Score = 39.1 bits (87), Expect = 0.003 Identities = 21/41 (51%), Positives = 25/41 (60%), Gaps = 2/41 (4%) Frame = +3 Query: 390 DPYEILGLPPGATQAEIKKSYRKQSLVLHPD--KETGDEKA 506 D Y IL L A + E+KK YRK +L LHPD K G E+A Sbjct: 62 DWYRILSLTAFADEEEVKKQYRKLALQLHPDKNKSVGAEEA 102 >02_01_0713 - 5332145-5332351,5332675-5332893,5334347-5334559, 5334637-5334730,5334860-5335020,5335114-5335315, 5335619-5335784,5336208-5336286 Length = 446 Score = 38.7 bits (86), Expect = 0.004 Identities = 17/32 (53%), Positives = 24/32 (75%) Frame = +3 Query: 390 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDK 485 D Y+ILG+ A+ AEIK++Y+K +L HPDK Sbjct: 327 DWYKILGISKTASAAEIKRAYKKLALQWHPDK 358 >08_02_0469 - 17531189-17531678,17531773-17531798,17533511-17533669 Length = 224 Score = 38.3 bits (85), Expect = 0.005 Identities = 22/65 (33%), Positives = 36/65 (55%), Gaps = 1/65 (1%) Frame = +3 Query: 390 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDK-ETGDEKAL*GSQRHTRLLQMMKRDVIG 566 D YEIL + AT +I+++YR+ ++ HPDK TG + A + T + ++IG Sbjct: 2 DYYEILHVDRSATDDDIRRAYRRLAMRWHPDKNHTGKKDAEAKFKDITEAYNIFDLNIIG 61 Query: 567 KXMVT 581 + M T Sbjct: 62 RRMKT 66 >01_01_1190 + 9463973-9465732,9466210-9466440,9467664-9467793, 9468723-9468888,9469528-9469859,9470284-9470513, 9471535-9471613,9471689-9471865 Length = 1034 Score = 38.3 bits (85), Expect = 0.005 Identities = 17/30 (56%), Positives = 21/30 (70%) Frame = +3 Query: 396 YEILGLPPGATQAEIKKSYRKQSLVLHPDK 485 Y ILG+ P T +IKK+YRK +L HPDK Sbjct: 947 YLILGIEPSCTFLDIKKAYRKAALRHHPDK 976 >03_01_0260 - 1999462-1999488,1999748-1999930,2000940-2001146, 2001895-2002359 Length = 293 Score = 37.9 bits (84), Expect = 0.007 Identities = 23/55 (41%), Positives = 29/55 (52%), Gaps = 5/55 (9%) Frame = +3 Query: 375 EMSNFDPYEILGLPPGATQA-----EIKKSYRKQSLVLHPDKETGDEKAL*GSQR 524 E + D YE+L LP G A +I+K+YR QS + HPDK D A QR Sbjct: 4 EDDDVDHYEVLCLPSGEEGAGLSLEQIEKAYRTQSRLRHPDKRPDDPNATADFQR 58 >01_07_0380 + 43181564-43181639,43182053-43182218,43182494-43182695, 43182789-43182949,43183079-43183172,43183250-43183462, 43184917-43185135,43185458-43185661 Length = 444 Score = 37.9 bits (84), Expect = 0.007 Identities = 16/38 (42%), Positives = 26/38 (68%) Frame = +3 Query: 390 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEK 503 D Y+ILG+ A+ A+IK++Y+K +L HPDK + + Sbjct: 326 DWYKILGISKTASAADIKRAYKKLALQWHPDKNVDNRE 363 >01_05_0646 + 23907837-23907956,23908077-23908164,23908282-23908364, 23908487-23908543,23908694-23908939 Length = 197 Score = 37.9 bits (84), Expect = 0.007 Identities = 15/32 (46%), Positives = 23/32 (71%) Frame = +3 Query: 396 YEILGLPPGATQAEIKKSYRKQSLVLHPDKET 491 Y +LG+ PGA+ AEI+ +Y + ++ HPDK T Sbjct: 17 YAVLGVHPGASAAEIRAAYHRLAMKWHPDKIT 48 >02_04_0220 - 21014225-21014386,21014492-21014572,21014739-21014938, 21014999-21015157,21015248-21015377,21015520-21015673, 21015785-21015867,21015981-21016040,21016131-21016217 Length = 371 Score = 37.5 bits (83), Expect = 0.009 Identities = 15/37 (40%), Positives = 25/37 (67%) Frame = +3 Query: 396 YEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEKA 506 Y++LG+ P A+ EI+K+Y ++ +HPDK D +A Sbjct: 8 YDVLGVCPAASDDEIRKAYYIKARQVHPDKNPNDPQA 44 >06_03_0339 - 19687749-19690805 Length = 1018 Score = 37.1 bits (82), Expect = 0.012 Identities = 18/32 (56%), Positives = 21/32 (65%) Frame = +3 Query: 390 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDK 485 D Y IL +P A IKK YRK +L+LHPDK Sbjct: 67 DWYGILQVPVTADDTLIKKQYRKLALLLHPDK 98 >08_02_0992 + 23380855-23381195,23382464-23382506,23383306-23383371, 23384228-23384428,23384450-23384707,23384798-23385013, 23385148-23385321,23386151-23386312,23386594-23386635 Length = 500 Score = 36.7 bits (81), Expect = 0.016 Identities = 18/52 (34%), Positives = 24/52 (46%) Frame = +3 Query: 396 YEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEKAL*GSQRHTRLLQMMK 551 YE+L + GAT E++ YR L HPDK +L S H + K Sbjct: 14 YEVLSVNEGATYDEVRAGYRAAILNAHPDKSQAKLDSLVSSVEHGEFFSVQK 65 >06_01_0806 - 6048042-6048138,6048461-6048550,6049362-6049425, 6049504-6049552,6050403-6050459,6050953-6051024, 6051912-6052003,6052542-6052614,6052686-6052748, 6052837-6052901,6053803-6053890,6053974-6054015, 6054097-6054188,6054601-6054688,6055134-6055225, 6055368-6055419 Length = 391 Score = 36.7 bits (81), Expect = 0.016 Identities = 16/39 (41%), Positives = 24/39 (61%) Frame = +3 Query: 390 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEKA 506 D Y+ILG+P A+Q EIK+++ + HPD G+ A Sbjct: 26 DYYKILGVPKDASQEEIKRAFHSLAKRYHPDTNRGNTAA 64 >03_02_0438 + 8470290-8470378,8470900-8470990,8471074-8471134, 8471678-8471755,8471891-8471964,8472689-8472802, 8472881-8472988,8473937-8473975,8474046-8474132 Length = 246 Score = 36.7 bits (81), Expect = 0.016 Identities = 16/32 (50%), Positives = 23/32 (71%) Frame = +3 Query: 390 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDK 485 +P+E L L ++ E+KK YRK SL++HPDK Sbjct: 38 NPFEHLKLSFDSSADEVKKQYRKLSLLVHPDK 69 >01_06_0406 + 29113033-29113119,29113250-29113309,29114104-29114186, 29114394-29114556,29114695-29114824,29115016-29115174, 29115295-29115464,29115590-29115670,29116492-29116536, 29116597-29117346,29117424-29117654 Length = 652 Score = 36.7 bits (81), Expect = 0.016 Identities = 15/37 (40%), Positives = 25/37 (67%) Frame = +3 Query: 396 YEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEKA 506 Y++LG+ A+ AEIKK+Y ++ ++HPDK + A Sbjct: 8 YDVLGVSTDASAAEIKKAYYLKAKLVHPDKNPNNPDA 44 >01_01_1212 + 9763949-9764412,9765183-9765252,9765356-9765457 Length = 211 Score = 36.7 bits (81), Expect = 0.016 Identities = 15/32 (46%), Positives = 24/32 (75%) Frame = +3 Query: 390 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDK 485 D Y+ LGL AT+AE+K ++R+++L HPD+ Sbjct: 4 DHYQTLGLRQDATKAEVKAAFRRRALRDHPDR 35 >12_02_1085 - 25935688-25935948,25936589-25936657,25937244-25937315, 25937693-25937791,25937927-25938007,25938099-25938586, 25938728-25938857,25939994-25940239 Length = 481 Score = 36.3 bits (80), Expect = 0.021 Identities = 17/45 (37%), Positives = 25/45 (55%), Gaps = 2/45 (4%) Frame = +3 Query: 378 MSNFDPYEILGLPPGAT--QAEIKKSYRKQSLVLHPDKETGDEKA 506 M YE+LG+P + Q +KK Y + L++HPDK G+ A Sbjct: 259 MDGLTHYEVLGIPRNRSIDQKILKKEYHRMVLLVHPDKNMGNPLA 303 >01_01_0976 + 7711634-7711801,7712741-7713183,7715813-7716251 Length = 349 Score = 36.3 bits (80), Expect = 0.021 Identities = 15/38 (39%), Positives = 24/38 (63%) Frame = +3 Query: 390 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEK 503 D Y++LG+ GA ++KK+Y K ++ HPDK + K Sbjct: 4 DYYKVLGVDRGAGDDDLKKAYHKLAMRWHPDKNPTNNK 41 >05_06_0267 - 26784861-26784896,26785324-26785404,26785530-26785702, 26785780-26785938,26786199-26786328,26786447-26786609, 26787027-26787109,26787605-26787664,26787819-26787940, 26789126-26789275,26789354-26789546,26790156-26790393, 26791240-26791320,26791403-26791647 Length = 637 Score = 35.9 bits (79), Expect = 0.027 Identities = 16/37 (43%), Positives = 24/37 (64%) Frame = +3 Query: 396 YEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEKA 506 Y+ LG+ A+ AEIKK+Y ++ +HPDK G+ A Sbjct: 322 YDTLGVSVDASPAEIKKAYYLKAKQVHPDKNPGNPDA 358 >02_05_0381 - 28483425-28483458,28483588-28483658,28483746-28483819, 28483975-28484050,28484129-28484206,28485557-28485589 Length = 121 Score = 35.5 bits (78), Expect = 0.036 Identities = 16/36 (44%), Positives = 23/36 (63%) Frame = +3 Query: 390 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDKETGD 497 D Y++L + A+ IK SYR+ +L+ HPDK GD Sbjct: 12 DYYKVLEVDYDASDDTIKLSYRRLALMWHPDKHKGD 47 >08_02_1491 + 27500532-27500972 Length = 146 Score = 35.1 bits (77), Expect = 0.048 Identities = 15/29 (51%), Positives = 20/29 (68%) Frame = +3 Query: 396 YEILGLPPGATQAEIKKSYRKQSLVLHPD 482 Y++LGL GAT EIK +YR+ + HPD Sbjct: 46 YDVLGLRAGATVREIKAAYRRLARERHPD 74 >06_01_0667 + 4878784-4878900,4879016-4879118,4879256-4879341, 4879434-4879496,4879589-4879831,4880639-4880728, 4881403-4881600 Length = 299 Score = 35.1 bits (77), Expect = 0.048 Identities = 13/32 (40%), Positives = 22/32 (68%) Frame = +3 Query: 390 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDK 485 D Y +LGL T A+++ +YRK +++ HPD+ Sbjct: 14 DLYAVLGLSRECTDADLRLAYRKLAMIWHPDR 45 >11_06_0179 + 20952070-20955228 Length = 1052 Score = 34.7 bits (76), Expect = 0.063 Identities = 23/60 (38%), Positives = 32/60 (53%), Gaps = 3/60 (5%) Frame = +3 Query: 390 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDKET--GDEKAL-*GSQRHTRLLQMMKRDV 560 D Y IL + A +A I+K YRK + LHPDK + G E A ++ H+ L KR + Sbjct: 66 DWYGILQVEATADEATIRKQYRKLAFSLHPDKNSFAGAEAAFKLVAEAHSLLCDPTKRPI 125 >03_06_0554 + 34691050-34691242,34691327-34691394,34691754-34692275 Length = 260 Score = 34.3 bits (75), Expect = 0.083 Identities = 14/34 (41%), Positives = 22/34 (64%) Frame = +3 Query: 390 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDKET 491 D Y +L + AT+ +++ YR+ +L LHPDK T Sbjct: 41 DWYLVLAVADAATEDAVRRRYRQLALQLHPDKNT 74 >02_05_0821 - 32019775-32019882,32020296-32020352,32020614-32020687, 32021508-32021583,32021796-32021873,32022130-32022228 Length = 163 Score = 34.3 bits (75), Expect = 0.083 Identities = 16/39 (41%), Positives = 25/39 (64%) Frame = +3 Query: 390 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEKA 506 D Y+IL + A++ I+ SY + +L HPDK+ G+E A Sbjct: 34 DYYKILEVGYDASEEAIRSSYIRLALKWHPDKKQGEENA 72 >02_01_0225 - 1469295-1469733,1472352-1472767,1473603-1473658, 1473827-1473995 Length = 359 Score = 34.3 bits (75), Expect = 0.083 Identities = 18/40 (45%), Positives = 24/40 (60%), Gaps = 1/40 (2%) Frame = +3 Query: 390 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDKE-TGDEKA 506 D Y IL + AT ++KKSYR+ + HPDK TG +A Sbjct: 4 DYYNILKVNRNATLEDLKKSYRRLARTWHPDKNPTGGAEA 43 >10_08_0580 - 18912364-18912420,18912524-18912631,18912973-18913212, 18913809-18913886,18914063-18914143,18914354-18914407, 18920402-18920545 Length = 253 Score = 33.9 bits (74), Expect = 0.11 Identities = 13/30 (43%), Positives = 21/30 (70%) Frame = +3 Query: 396 YEILGLPPGATQAEIKKSYRKQSLVLHPDK 485 Y +L L P A+ EI+++YR+ + + HPDK Sbjct: 14 YALLHLSPDASGEEIRRAYRQYAQIYHPDK 43 >07_03_1296 + 25583195-25584385 Length = 396 Score = 33.9 bits (74), Expect = 0.11 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = +3 Query: 390 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEKAL 509 DP +L L P AE+K+SYR+ S +L + G + AL Sbjct: 71 DPIAVLHLQPNPDPAEVKRSYRRLSNLLSSNPRPGADAAL 110 >03_03_0278 - 16126803-16129049 Length = 748 Score = 33.9 bits (74), Expect = 0.11 Identities = 16/32 (50%), Positives = 18/32 (56%) Frame = +3 Query: 390 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDK 485 D Y IL + A +KK YRK L LHPDK Sbjct: 66 DWYSILSVESSADDETLKKQYRKLVLQLHPDK 97 >01_05_0147 + 18597194-18597643,18598347-18598681,18600073-18600147, 18600325-18600427,18601554-18601642,18602953-18603064, 18604093-18604146,18604271-18604319,18606236-18606347, 18606389-18606436,18607000-18607327 Length = 584 Score = 33.9 bits (74), Expect = 0.11 Identities = 14/31 (45%), Positives = 21/31 (67%) Frame = +3 Query: 393 PYEILGLPPGATQAEIKKSYRKQSLVLHPDK 485 PY+++G+ + IKK Y K SL++HPDK Sbjct: 333 PYDVVGINWKMSSDNIKKRYWKLSLLVHPDK 363 >05_06_0167 - 26104527-26104567,26105130-26105226,26105377-26105415, 26105628-26105678,26105978-26106059,26106222-26106282, 26106380-26106509,26106630-26106758,26107057-26107314 Length = 295 Score = 33.5 bits (73), Expect = 0.15 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = +3 Query: 390 DPYEILGLPPGATQAEIKKSYRKQSLVLHPD 482 D Y +LG+ P AT EIKK+Y HPD Sbjct: 79 DFYSVLGVMPDATPEEIKKAYYSCMKACHPD 109 >05_03_0564 - 15502458-15503303,15503394-15503474,15503572-15503620, 15503786-15503828,15504576-15504633,15504720-15504858, 15504980-15505107 Length = 447 Score = 33.5 bits (73), Expect = 0.15 Identities = 17/40 (42%), Positives = 25/40 (62%), Gaps = 2/40 (5%) Frame = +3 Query: 390 DPYEILGLPPGATQAEIKKSYRKQSLVLHPD--KETGDEK 503 D Y LG+ A+++EIK +YRK + HPD K+ G E+ Sbjct: 90 DFYSTLGVSRNASKSEIKSAYRKLARSYHPDVNKDPGAEQ 129 >05_03_0563 - 15493570-15494415,15494506-15494586,15494684-15494732, 15494898-15494940,15495688-15495745,15495832-15495970, 15496092-15496219 Length = 447 Score = 33.5 bits (73), Expect = 0.15 Identities = 17/40 (42%), Positives = 25/40 (62%), Gaps = 2/40 (5%) Frame = +3 Query: 390 DPYEILGLPPGATQAEIKKSYRKQSLVLHPD--KETGDEK 503 D Y LG+ A+++EIK +YRK + HPD K+ G E+ Sbjct: 90 DFYSTLGVSRNASKSEIKSAYRKLARSYHPDVNKDPGAEQ 129 >05_03_0562 - 15484733-15485578,15485669-15485749,15485847-15485895, 15486061-15486103,15486851-15486908,15486995-15487133, 15487255-15487382 Length = 447 Score = 33.5 bits (73), Expect = 0.15 Identities = 17/40 (42%), Positives = 25/40 (62%), Gaps = 2/40 (5%) Frame = +3 Query: 390 DPYEILGLPPGATQAEIKKSYRKQSLVLHPD--KETGDEK 503 D Y LG+ A+++EIK +YRK + HPD K+ G E+ Sbjct: 90 DFYSTLGVSRNASKSEIKSAYRKLARSYHPDVNKDPGAEQ 129 >01_05_0090 + 18038219-18038421,18039365-18039488,18040229-18040311, 18040401-18040473,18040584-18040688,18040803-18040853, 18041705-18041781,18041879-18042037,18043548-18043692, 18043776-18043884,18043959-18044107,18044175-18044258, 18044784-18044825,18045811-18046014 Length = 535 Score = 33.5 bits (73), Expect = 0.15 Identities = 13/26 (50%), Positives = 19/26 (73%) Frame = +3 Query: 390 DPYEILGLPPGATQAEIKKSYRKQSL 467 DPYE+L +P ++ EIK +YRK +L Sbjct: 18 DPYEVLSVPRDSSDQEIKSAYRKLAL 43 >03_06_0568 - 34778408-34778710,34779340-34779411,34779549-34779635, 34779722-34779880,34780641-34780739,34780823-34780903, 34781007-34781461,34781550-34781679,34781952-34782743 Length = 725 Score = 33.1 bits (72), Expect = 0.19 Identities = 10/23 (43%), Positives = 20/23 (86%) Frame = +3 Query: 438 IKKSYRKQSLVLHPDKETGDEKA 506 +K+ Y+K+++++HPDK G++KA Sbjct: 452 LKREYKKKAMLVHPDKNMGNDKA 474 >01_06_0592 + 30465956-30466210,30466401-30466529,30466631-30466760, 30466861-30466981,30467111-30467192,30467334-30467384, 30467836-30467929,30468046-30468173 Length = 329 Score = 33.1 bits (72), Expect = 0.19 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = +3 Query: 390 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDKETGD 497 D Y +LG+ P AT +IKK+Y HPD D Sbjct: 78 DYYAVLGVMPDATPQQIKKAYYNCMKACHPDLSGND 113 >01_01_1211 + 9753518-9753894,9754265-9754313,9754747-9754773 Length = 150 Score = 33.1 bits (72), Expect = 0.19 Identities = 13/39 (33%), Positives = 24/39 (61%) Frame = +3 Query: 390 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEKA 506 D Y LG+ GA++AE+K ++ + + + HPD+ + A Sbjct: 8 DYYRTLGIERGASKAEVKAAFYRLAPLHHPDRHAASDAA 46 >03_06_0049 + 31282563-31282841,31283052-31283903,31284109-31284194, 31284544-31284678,31285087-31285252 Length = 505 Score = 32.7 bits (71), Expect = 0.25 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = +3 Query: 369 DYEMSNFDPYEILGLPPGATQAEIKKSYRKQSLVLHPD 482 D E++ YE+LG+ ++ AEIK S+ + + HPD Sbjct: 38 DDELAGKSAYEVLGVGETSSSAEIKASFHRLAKETHPD 75 >12_01_0438 + 3455686-3455692,3456149-3456240,3457422-3457505, 3457598-3457636,3457952-3458041,3458567-3458611, 3458702-3458789,3458902-3458966,3459063-3459137, 3460231-3460303,3460708-3460799,3460896-3460967, 3461165-3461221,3461316-3461364,3461522-3461610 Length = 338 Score = 32.3 bits (70), Expect = 0.34 Identities = 18/60 (30%), Positives = 30/60 (50%) Frame = +3 Query: 378 MSNFDPYEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEKAL*GSQRHTRLLQMMKRD 557 M+ D Y++LG+ A+ ++IKK+Y + HPD D A Q +++K D Sbjct: 7 MNARDYYDVLGVNKDASASDIKKAYYLLAKKFHPDTNKEDADAEKKFQEVQHAYEVLKDD 66 >05_07_0247 + 28643862-28644310,28645151-28645207,28645644-28648950, 28649069-28649144,28649356-28649426,28649524-28649589, 28649677-28649766,28649874-28650050,28650513-28650548 Length = 1442 Score = 32.3 bits (70), Expect = 0.34 Identities = 17/49 (34%), Positives = 26/49 (53%) Frame = +3 Query: 339 GFLAYKVSQFDYEMSNFDPYEILGLPPGATQAEIKKSYRKQSLVLHPDK 485 G L +S Y + ++ + L T A +KK+YRK +L +HPDK Sbjct: 1361 GNLRALLSTLQYILGADSGWQPVPLTELITAAAVKKAYRKATLCVHPDK 1409 >03_05_0019 + 19862171-19863049 Length = 292 Score = 32.3 bits (70), Expect = 0.34 Identities = 17/39 (43%), Positives = 22/39 (56%), Gaps = 5/39 (12%) Frame = +3 Query: 390 DPYEILGLPPGATQA-----EIKKSYRKQSLVLHPDKET 491 D Y +LGLP + +KK YRK L++HPDK T Sbjct: 75 DWYAMLGLPQPRSDLVTHHDAVKKQYRKLCLLVHPDKNT 113 >01_07_0010 + 40429613-40429677,40429702-40430015,40432150-40434386 Length = 871 Score = 32.3 bits (70), Expect = 0.34 Identities = 18/41 (43%), Positives = 22/41 (53%), Gaps = 2/41 (4%) Frame = +3 Query: 390 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDKE--TGDEKA 506 D Y IL + +IKK YRK +L HPDK +G E A Sbjct: 193 DLYGILDISASDDDEKIKKQYRKLALQTHPDKNKFSGAESA 233 >01_04_0054 - 15456668-15459691 Length = 1007 Score = 31.9 bits (69), Expect = 0.45 Identities = 15/32 (46%), Positives = 20/32 (62%) Frame = +3 Query: 390 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDK 485 D Y +L + A +A IKK +RK + LHPDK Sbjct: 66 DFYGVLQVDVMADEATIKKQFRKLAFSLHPDK 97 >01_03_0254 - 14276308-14276313,14277101-14277277,14278290-14278688 Length = 193 Score = 31.9 bits (69), Expect = 0.45 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = +3 Query: 426 TQAEIKKSYRKQSLVLHPDK 485 T A +KK YRK +L +HPDK Sbjct: 151 TAASVKKEYRKATLCIHPDK 170 >11_06_0632 + 25674807-25675477,25676472-25677861,25677948-25678083, 25678185-25678282,25678470-25678535,25678699-25678827, 25679570-25679746,25680576-25680614 Length = 901 Score = 31.5 bits (68), Expect = 0.59 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +3 Query: 396 YEILGLPPGATQAEIKKSYRKQSLVLHPDK 485 ++ + L T A +KK YRK +L +HPDK Sbjct: 838 WQAVSLTDLITGAAVKKQYRKATLCIHPDK 867 >09_04_0406 + 17340129-17340650 Length = 173 Score = 31.5 bits (68), Expect = 0.59 Identities = 17/52 (32%), Positives = 23/52 (44%) Frame = +3 Query: 396 YEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEKAL*GSQRHTRLLQMMK 551 YE+L + AT EI+ +Y+ L HPDK L S L + K Sbjct: 14 YEVLSVRKDATYDEIRAAYKSAVLNTHPDKAQMALNPLVSSSERNEFLSVQK 65 >08_02_0878 + 22152437-22152532,22152619-22152718,22152907-22152974, 22153085-22153141,22153243-22153350,22153888-22153971 Length = 170 Score = 31.5 bits (68), Expect = 0.59 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = +3 Query: 396 YEILGLPPGATQAEIKKSYRKQSLVLHPDK 485 Y +LG+ + A+++ +YRK ++ HPDK Sbjct: 9 YAVLGVASDCSDADLRTAYRKLAMKWHPDK 38 >04_04_1571 + 34504087-34504421,34505002-34505731,34506091-34512077, 34512493-34513964,34514114-34514377,34514761-34514978, 34515759-34516030,34516190-34516559,34516578-34516797, 34516819-34518931,34518941-34519193,34519269-34519401, 34520597-34521114,34521207-34522115,34522195-34522368, 34522833-34522882,34523963-34524035,34524413-34524477, 34524736-34525522,34525622-34525878,34525989-34526109, 34526315-34526956 Length = 5320 Score = 31.5 bits (68), Expect = 0.59 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +3 Query: 378 MSNFDPYEILGLPPGATQAEIKKSYRKQSLVLHPD 482 ++ +D Y +LG+ + Q+EIK +YR HPD Sbjct: 4916 VTEYDLYGLLGVERSSPQSEIKAAYRSLQKRCHPD 4950 >03_02_0727 - 10742899-10744375,10744470-10744933,10745412-10745477 Length = 668 Score = 31.5 bits (68), Expect = 0.59 Identities = 13/37 (35%), Positives = 24/37 (64%) Frame = +3 Query: 375 EMSNFDPYEILGLPPGATQAEIKKSYRKQSLVLHPDK 485 E N D Y +LG+ G T++E+++++ +L L PD+ Sbjct: 416 EACNIDYYALLGVRRGCTRSELERAHLLLTLKLKPDR 452 >01_05_0808 - 25414486-25414677,25415114-25415290,25415839-25415928, 25416016-25416081,25416170-25416240,25416375-25416450, 25416567-25420098,25421464-25421834 Length = 1524 Score = 31.5 bits (68), Expect = 0.59 Identities = 15/49 (30%), Positives = 27/49 (55%) Frame = +3 Query: 339 GFLAYKVSQFDYEMSNFDPYEILGLPPGATQAEIKKSYRKQSLVLHPDK 485 G L +S Y + + + ++ + L T +KK+YR+ +L +HPDK Sbjct: 1391 GNLRALLSTLQYILGSDNGWQSVPLTDLITATAVKKAYRRATLCVHPDK 1439 >11_08_0055 - 28095996-28096934 Length = 312 Score = 31.1 bits (67), Expect = 0.78 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = +1 Query: 79 MGGQKFEYDESGSTFFYFVLSFLALILVPATFYYWPKKRKEDPA 210 M Q+ + F+F+LS LA+ PA YY P+ +++ A Sbjct: 1 MASQRRRSSAATIAVFFFLLSLLAVFFQPAAAYYHPQGKRQTVA 44 >12_02_0693 - 22207582-22207620,22208421-22208597,22209258-22209347, 22210215-22210280,22210473-22210570,22210669-22210789, 22210875-22212477,22213332-22213915 Length = 925 Score = 30.7 bits (66), Expect = 1.0 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = +3 Query: 426 TQAEIKKSYRKQSLVLHPDK 485 T A +KK YRK +L +HPDK Sbjct: 872 TAAAVKKVYRKATLCIHPDK 891 >03_02_0704 - 10542187-10542339,10542466-10542522,10542667-10542737, 10542823-10542901,10543021-10543161 Length = 166 Score = 30.3 bits (65), Expect = 1.4 Identities = 10/34 (29%), Positives = 21/34 (61%) Frame = +3 Query: 396 YEILGLPPGATQAEIKKSYRKQSLVLHPDKETGD 497 Y +LG+ A+ +++ +YR+ ++ HPD+ D Sbjct: 24 YSLLGIRKNASATDVRAAYRRLAMKWHPDRCVSD 57 >01_01_0013 + 81507-81932,82718-82864 Length = 190 Score = 29.9 bits (64), Expect = 1.8 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +3 Query: 396 YEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEKA 506 Y++LG+ T E++ +YR+ + HPD D A Sbjct: 56 YDLLGISSEGTLDEVRAAYRRMARKYHPDVSPPDAAA 92 >07_03_1759 + 29285262-29287208 Length = 648 Score = 29.5 bits (63), Expect = 2.4 Identities = 12/37 (32%), Positives = 24/37 (64%) Frame = +3 Query: 375 EMSNFDPYEILGLPPGATQAEIKKSYRKQSLVLHPDK 485 E + D Y +LG+ G T++E+++++ +L L PD+ Sbjct: 451 EACSVDYYALLGVRRGCTRSELERAHLLLTLKLRPDR 487 >12_01_0915 - 8908643-8908756,8909086-8909203,8909570-8909682, 8911138-8911218,8911307-8911357,8912173-8912232, 8913353-8913419,8913509-8913759 Length = 284 Score = 29.1 bits (62), Expect = 3.1 Identities = 14/26 (53%), Positives = 16/26 (61%) Frame = +3 Query: 423 ATQAEIKKSYRKQSLVLHPDKETGDE 500 A +EIKK+Y K SL HPDK E Sbjct: 68 ANVSEIKKAYYKLSLKHHPDKNPDPE 93 >03_06_0601 + 34991912-34992352,34993719-34994516 Length = 412 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +3 Query: 426 TQAEIKKSYRKQSLVLHPDKET 491 T +K+ YR+ LVLHPDK + Sbjct: 96 THESLKQQYRRLCLVLHPDKNS 117 >03_06_0599 + 34984869-34985319,34986581-34987563 Length = 477 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +3 Query: 426 TQAEIKKSYRKQSLVLHPDKET 491 T +K+ YR+ LVLHPDK + Sbjct: 277 THKSLKQQYRRLCLVLHPDKNS 298 Score = 28.3 bits (60), Expect = 5.5 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 420 GATQAEIKKSYRKQSLVLHPDK 485 G T +K+ Y + LV+HPDK Sbjct: 88 GVTHESLKRQYHRLCLVVHPDK 109 >02_01_0383 + 2776526-2776632,2777579-2777835,2777915-2778366, 2778845-2779102 Length = 357 Score = 29.1 bits (62), Expect = 3.1 Identities = 15/56 (26%), Positives = 29/56 (51%) Frame = +3 Query: 315 IVSGWVLLGFLAYKVSQFDYEMSNFDPYEILGLPPGATQAEIKKSYRKQSLVLHPD 482 +V G + G L K Q ++ DP + L +P ++ ++ S+ ++SL+ H D Sbjct: 10 VVVGGGIAGSLLAKTMQPHADVVLLDPKDYLEIPWAELRSMVEPSFAERSLIYHRD 65 >07_03_1417 + 26418131-26418178,26418410-26418502,26418861-26418891, 26419011-26419037,26419115-26419235,26419320-26419374 Length = 124 Score = 28.7 bits (61), Expect = 4.1 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +3 Query: 399 EILGLPPGA--TQAEIKKSYRKQSLVLHPDKETGDEKA 506 E+LGLP + +E+K +YR+ + HPD+ +K+ Sbjct: 2 ELLGLPAHTRPSPSEVKAAYRRMVMESHPDRVPTHQKS 39 >07_01_0042 - 334417-334431,334563-334688,334852-335136,335220-335368, 336239-336536,337030-337131,337245-337613,337973-338115, 338334-338518,339246-339475,339734-339821,340158-340253, 340397-340512,340604-340852,340950-341175,341411-341622 Length = 962 Score = 28.7 bits (61), Expect = 4.1 Identities = 17/34 (50%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = +3 Query: 339 GFLAY-KVSQFDYEMSNFDPYEILGLPPGATQAE 437 G LAY S F YEM F PYE PP +AE Sbjct: 403 GDLAYPNPSSFTYEMRFFSPYEYALQPPPWYRAE 436 >03_02_0030 + 5129234-5129568,5130020-5130651,5130936-5131243, 5131396-5131504,5131871-5131956,5132173-5132232, 5133164-5133340,5133742-5133780 Length = 581 Score = 28.7 bits (61), Expect = 4.1 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +3 Query: 381 SNFDPYEILGLPPGATQAEIKKSYRKQSLVLHPDK 485 S + P ++ + GA +KK+Y+K L LHPDK Sbjct: 516 SGWKPVPLVDIIEGAA---VKKAYQKALLCLHPDK 547 >11_01_0725 - 5987706-5988126,5988610-5988902 Length = 237 Score = 28.3 bits (60), Expect = 5.5 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +3 Query: 405 LGLPPGATQAEIKKSYRKQSLVLHPD 482 LG+ P A EIK +YR+ S HPD Sbjct: 100 LGVEPKADIEEIKAAYRRLSKEYHPD 125 >06_03_0151 + 17270688-17270698,17271149-17271281,17271548-17271589, 17271706-17271815,17271957-17272035,17272114-17272287, 17272386-17272466,17272761-17272988,17273067-17273402, 17273501-17273586,17273642-17273783,17274596-17274687, 17274770-17274904,17275142-17275304,17275393-17275482, 17275568-17275753,17276109-17276141,17276700-17276762, 17276839-17276901,17276983-17277042,17277258-17277410, 17277530-17277613,17278434-17278610,17278685-17278791, 17278858-17279071,17279158-17279261,17279926-17280061, 17280191-17280316,17280682-17280792,17280968-17281066, 17281367-17281633,17281707-17281822,17281853-17282084, 17282597-17282664,17282682-17282807,17282980-17283040 Length = 1495 Score = 28.3 bits (60), Expect = 5.5 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = +3 Query: 390 DPYEILGLPPGATQAEIKKSYRK 458 D Y++LG+ +T EIK++YRK Sbjct: 1440 DYYQVLGVTVNSTPQEIKEAYRK 1462 >03_02_0205 + 6389343-6389609,6390418-6390486,6390662-6390757, 6391120-6391244,6391331-6391483,6392863-6392992, 6393122-6393282,6393660-6393702,6393869-6394042, 6394471-6394525,6394567-6394746,6396234-6396339, 6396448-6396506,6397419-6397541,6397825-6397919 Length = 611 Score = 28.3 bits (60), Expect = 5.5 Identities = 17/45 (37%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = +3 Query: 375 EMSNFDPYEILGLPPGATQAEIKKSYRKQSLVLHPD--KETGDEK 503 E D Y L L AT E+K +YR + HPD K+ G E+ Sbjct: 58 ERGGKDYYATLNLRRDATLQEVKTAYRTLARKYHPDMNKDPGAEE 102 >12_02_0488 + 19587337-19587648,19587739-19587798,19587876-19587941, 19588017-19588082,19588253-19588345 Length = 198 Score = 27.5 bits (58), Expect = 9.6 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = +3 Query: 201 RSCKISRKMSVSKLC*QTLIIEQSQPY 281 RS ++ KMSVSK C ++ E SQ Y Sbjct: 95 RSKEVRTKMSVSKACKHSVSAESSQSY 121 >10_08_1023 - 22341815-22342042,22342179-22342247,22342717-22342840, 22343193-22343317,22343815-22344276,22344357-22344700, 22345061-22345406,22345492-22345941,22346760-22347051, 22347171-22347515,22347611-22347834,22348072-22348563, 22348664-22349056,22349601-22349741,22349845-22350207, 22350494-22352683,22353298-22353360,22353434-22353535, 22353672-22354027,22354326-22354413,22354517-22354750, 22355508-22355975 Length = 2632 Score = 27.5 bits (58), Expect = 9.6 Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = +3 Query: 429 QAEIKKSYRKQSLVLHPDKE-TGDEKAL*GSQRHTRLLQMMK 551 + ++K+ YRK ++ HPDK G EK + + + RL M+ Sbjct: 1593 EEKLKRQYRKLAIKYHPDKNPEGREKFVAVQKAYERLQASMQ 1634 >10_08_0184 - 15570471-15570684,15571085-15571354,15571489-15571711, 15571809-15571875,15571996-15572137,15572226-15572290 Length = 326 Score = 27.5 bits (58), Expect = 9.6 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +3 Query: 141 ISCINISTSYILLLA*KTKRRSCKISR 221 I+ NI +Y+LLL+ TK +SC R Sbjct: 241 ITAANILLNYVLLLSRNTKSKSCPFCR 267 >09_06_0281 + 22014394-22015534,22016041-22017056 Length = 718 Score = 27.5 bits (58), Expect = 9.6 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = -3 Query: 600 HAPGPSGLPYXSQLRLASSSVRA 532 H GP LP+ +LR+A+ + RA Sbjct: 543 HVEGPMSLPWEDRLRIATETARA 565 >09_04_0165 + 15274448-15277336 Length = 962 Score = 27.5 bits (58), Expect = 9.6 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 Query: 269 IAALQKREKFLCETCYSIWMGATWIS 346 IAALQ+ E FL +S+WM T ++ Sbjct: 933 IAALQRNENFLEAVKWSLWMKQTGVA 958 >07_01_0069 + 505291-505327,505726-505956,506317-506652,507025-507372, 507735-508594,508902-508971,509157-509371,509477-509537, 509606-509715,510644-510694,510794-510916 Length = 813 Score = 27.5 bits (58), Expect = 9.6 Identities = 21/55 (38%), Positives = 25/55 (45%), Gaps = 3/55 (5%) Frame = +3 Query: 393 PYEILGLPPGATQAEIKKSY---RKQSLVLHPDKETGDEKAL*GSQRHTRLLQMM 548 PY+ LG PP SY + SLVL P D+ + G T LLQMM Sbjct: 692 PYKALGNPPHTAIFPHPYSYLNKKDDSLVLMPIFHEQDQVEIFGCIWRTLLLQMM 746 >03_02_0845 - 11700830-11701327 Length = 165 Score = 27.5 bits (58), Expect = 9.6 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +3 Query: 396 YEILGLPPGATQAEIKKSYRKQSLVLHPD 482 YE+L + A EIK +YR+ + HPD Sbjct: 56 YEVLAVEETAGAEEIKAAYRRAARRWHPD 84 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,320,348 Number of Sequences: 37544 Number of extensions: 315231 Number of successful extensions: 737 Number of sequences better than 10.0: 95 Number of HSP's better than 10.0 without gapping: 701 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 737 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1584867848 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -