BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060717.seq (641 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56859| Best HMM Match : rve (HMM E-Value=4.8e-35) 68 6e-12 SB_17567| Best HMM Match : DnaJ (HMM E-Value=0.0007) 48 6e-06 SB_3383| Best HMM Match : DnaJ (HMM E-Value=3.8e-40) 48 6e-06 SB_49296| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_31961| Best HMM Match : EGF (HMM E-Value=0) 46 3e-05 SB_293| Best HMM Match : DnaJ (HMM E-Value=7.6e-37) 46 3e-05 SB_43852| Best HMM Match : DnaJ (HMM E-Value=1.7e-37) 45 5e-05 SB_31923| Best HMM Match : DnaJ (HMM E-Value=2.8e-38) 45 6e-05 SB_20922| Best HMM Match : RVT_1 (HMM E-Value=0) 43 2e-04 SB_34890| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) 42 6e-04 SB_16146| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) 42 6e-04 SB_2842| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_24444| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_16477| Best HMM Match : DnaJ (HMM E-Value=8.1e-33) 41 7e-04 SB_41006| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_34242| Best HMM Match : DnaJ (HMM E-Value=9.2e-30) 40 0.001 SB_11933| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_3343| Best HMM Match : DnaJ (HMM E-Value=0.067) 40 0.002 SB_59454| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_42340| Best HMM Match : DnaJ (HMM E-Value=3.2e-32) 40 0.002 SB_37512| Best HMM Match : DnaJ (HMM E-Value=1.3e-29) 40 0.002 SB_21898| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_6887| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_39063| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_56064| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_21411| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_21966| Best HMM Match : DnaJ (HMM E-Value=5.30001e-40) 38 0.007 SB_48086| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.021 SB_2302| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.049 SB_13439| Best HMM Match : DnaJ (HMM E-Value=5.9e-24) 35 0.049 SB_58160| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.065 SB_2261| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.065 SB_45438| Best HMM Match : DnaJ (HMM E-Value=4.4e-26) 35 0.065 SB_13154| Best HMM Match : DnaJ (HMM E-Value=7.9e-11) 32 0.34 SB_29448| Best HMM Match : DnaJ (HMM E-Value=0.00022) 32 0.34 SB_24982| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.34 SB_15221| Best HMM Match : ASC (HMM E-Value=0.0016) 31 1.1 SB_29418| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_16586| Best HMM Match : DnaJ (HMM E-Value=4.9e-10) 29 4.2 SB_47290| Best HMM Match : Ank (HMM E-Value=5.4e-29) 28 7.4 SB_56512| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 27 9.8 SB_21236| Best HMM Match : Toxin_8 (HMM E-Value=10) 27 9.8 SB_11571| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.8 SB_17384| Best HMM Match : zf-C2H2 (HMM E-Value=0) 27 9.8 SB_2148| Best HMM Match : WSC (HMM E-Value=0.039) 27 9.8 >SB_56859| Best HMM Match : rve (HMM E-Value=4.8e-35) Length = 1671 Score = 68.1 bits (159), Expect = 6e-12 Identities = 30/63 (47%), Positives = 42/63 (66%) Frame = +3 Query: 315 IVSGWVLLGFLAYKVSQFDYEMSNFDPYEILGLPPGATQAEIKKSYRKQSLVLHPDKETG 494 IV W++ AYK+SQFD + + +DPY +L + GA+ AEI++ YR S HPDKETG Sbjct: 1223 IVILWIVFFAGAYKISQFDRDFAEYDPYAVLEIDRGASVAEIRRQYRSLSKKYHPDKETG 1282 Query: 495 DEK 503 D + Sbjct: 1283 DPR 1285 Score = 41.1 bits (92), Expect = 7e-04 Identities = 14/20 (70%), Positives = 19/20 (95%) Frame = +2 Query: 536 LTDDEARRNWEXYGNPDGPG 595 LT++E+R+NWE +GNPDGPG Sbjct: 1313 LTNEESRKNWEEHGNPDGPG 1332 >SB_17567| Best HMM Match : DnaJ (HMM E-Value=0.0007) Length = 831 Score = 48.0 bits (109), Expect = 6e-06 Identities = 18/32 (56%), Positives = 26/32 (81%) Frame = +3 Query: 390 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDK 485 DPY ILG+PP A+ +IK+ YRK ++++HPDK Sbjct: 800 DPYSILGVPPEASDDDIKRQYRKLAVLIHPDK 831 >SB_3383| Best HMM Match : DnaJ (HMM E-Value=3.8e-40) Length = 250 Score = 48.0 bits (109), Expect = 6e-06 Identities = 26/65 (40%), Positives = 39/65 (60%), Gaps = 5/65 (7%) Frame = +3 Query: 390 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDK-----ETGDEKAL*GSQRHTRLLQMMKR 554 D YE+LG+P A++ ++KK+YR+Q+L HPDK E +EK S+ + L KR Sbjct: 4 DYYEVLGVPRSASEEDVKKAYRRQALRWHPDKNPTNREHAEEKFKKLSEAYEVLSDKEKR 63 Query: 555 DVIGK 569 D+ K Sbjct: 64 DIYDK 68 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = +2 Query: 500 EGFMRLTKAYQALTDDEARRNWEXYG 577 E F +L++AY+ L+D E R ++ YG Sbjct: 45 EKFKKLSEAYEVLSDKEKRDIYDKYG 70 >SB_49296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 966 Score = 46.0 bits (104), Expect = 3e-05 Identities = 20/30 (66%), Positives = 23/30 (76%) Frame = +3 Query: 396 YEILGLPPGATQAEIKKSYRKQSLVLHPDK 485 Y+IL +PP AT EIKKSYRK +L HPDK Sbjct: 67 YDILNVPPTATATEIKKSYRKLALKYHPDK 96 >SB_31961| Best HMM Match : EGF (HMM E-Value=0) Length = 2813 Score = 45.6 bits (103), Expect = 3e-05 Identities = 27/71 (38%), Positives = 43/71 (60%), Gaps = 2/71 (2%) Frame = +3 Query: 303 VKLAIVSGWVLL-GFLAYKVSQFDY-EMSNFDPYEILGLPPGATQAEIKKSYRKQSLVLH 476 V +VSG+V + + + + FD E + Y++LG+ ATQAEI+++YR+ SL LH Sbjct: 2452 VLFILVSGFVCVHAWDSVDLELFDIVEEVKDNFYQVLGVETTATQAEIRRAYRRISLQLH 2511 Query: 477 PDKETGDEKAL 509 PD+ D+ L Sbjct: 2512 PDRNKEDDAEL 2522 >SB_293| Best HMM Match : DnaJ (HMM E-Value=7.6e-37) Length = 238 Score = 45.6 bits (103), Expect = 3e-05 Identities = 20/39 (51%), Positives = 28/39 (71%) Frame = +3 Query: 390 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEKA 506 D Y ILG+P A++ +IK++YRK ++ LHPDK D KA Sbjct: 25 DFYAILGVPRDASKNQIKRAYRKLAMKLHPDKNKDDPKA 63 >SB_43852| Best HMM Match : DnaJ (HMM E-Value=1.7e-37) Length = 399 Score = 45.2 bits (102), Expect = 5e-05 Identities = 21/32 (65%), Positives = 23/32 (71%) Frame = +3 Query: 390 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDK 485 D Y+ILGL AT A+IKK YRK SL HPDK Sbjct: 4 DYYDILGLTRSATDADIKKEYRKLSLKYHPDK 35 >SB_31923| Best HMM Match : DnaJ (HMM E-Value=2.8e-38) Length = 161 Score = 44.8 bits (101), Expect = 6e-05 Identities = 23/58 (39%), Positives = 35/58 (60%), Gaps = 3/58 (5%) Frame = +3 Query: 396 YEILGLPPGATQAEIKKSYRKQSLVLHPDKET---GDEKAL*GSQRHTRLLQMMKRDV 560 Y ILG+P A+ +IKK+YR+Q+L+ HPDK +EK S+ + L +RD+ Sbjct: 6 YAILGVPRNASDDDIKKAYRRQALIFHPDKNKNSGAEEKFKEISEAYKVLTDPRQRDI 63 >SB_20922| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 576 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/37 (45%), Positives = 26/37 (70%) Frame = +3 Query: 390 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDE 500 D Y+ILG+P A+ +IKK++RK ++ HPDK G + Sbjct: 26 DYYQILGVPRNASDKQIKKAFRKMAVKYHPDKNKGKD 62 >SB_34890| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) Length = 386 Score = 41.5 bits (93), Expect = 6e-04 Identities = 18/37 (48%), Positives = 28/37 (75%), Gaps = 2/37 (5%) Frame = +3 Query: 396 YEILGLPPGATQAEIKKSYRKQSLVLHPDK--ETGDE 500 Y++LG+P A+ +IKK+YRK + LHPDK +TG++ Sbjct: 7 YDLLGVPQNASDNDIKKAYRKLAKELHPDKNPDTGEK 43 >SB_16146| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) Length = 79 Score = 41.5 bits (93), Expect = 6e-04 Identities = 18/37 (48%), Positives = 28/37 (75%), Gaps = 2/37 (5%) Frame = +3 Query: 396 YEILGLPPGATQAEIKKSYRKQSLVLHPDK--ETGDE 500 Y++LG+P A+ +IKK+YRK + LHPDK +TG++ Sbjct: 7 YDLLGVPQNASDNDIKKAYRKLAKELHPDKNPDTGEK 43 >SB_2842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 257 Score = 41.5 bits (93), Expect = 6e-04 Identities = 17/36 (47%), Positives = 27/36 (75%) Frame = +3 Query: 396 YEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEK 503 Y++LG+ A+++EIK++YRK SL +HPD+ EK Sbjct: 17 YDVLGVSKTASESEIKRAYRKISLQVHPDRADKGEK 52 >SB_24444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 268 Score = 41.1 bits (92), Expect = 7e-04 Identities = 18/41 (43%), Positives = 29/41 (70%), Gaps = 2/41 (4%) Frame = +3 Query: 390 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDKET--GDEKA 506 D YE LG+ GAT+ +I ++Y+K ++++HPDK G E+A Sbjct: 143 DHYERLGIQQGATKDDINRAYKKLAVLIHPDKSVAPGSEEA 183 >SB_16477| Best HMM Match : DnaJ (HMM E-Value=8.1e-33) Length = 138 Score = 41.1 bits (92), Expect = 7e-04 Identities = 18/32 (56%), Positives = 24/32 (75%) Frame = +3 Query: 390 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDK 485 D Y+IL +P A++ +IKKSYRK +L HPDK Sbjct: 3 DYYDILEVPRSASEQDIKKSYRKLALKWHPDK 34 >SB_41006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 725 Score = 40.7 bits (91), Expect = 0.001 Identities = 16/36 (44%), Positives = 25/36 (69%) Frame = +3 Query: 396 YEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEK 503 YE+LG+ AT +I+++YR+ +L HPDK G E+ Sbjct: 6 YEVLGVERNATTDDIRRAYRRLALKYHPDKNAGTEE 41 >SB_34242| Best HMM Match : DnaJ (HMM E-Value=9.2e-30) Length = 238 Score = 40.3 bits (90), Expect = 0.001 Identities = 16/36 (44%), Positives = 25/36 (69%) Frame = +3 Query: 396 YEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEK 503 Y +LG+ P A+Q++IK +Y K S+ HPD+ G +K Sbjct: 74 YNVLGVSPKASQSKIKDAYYKLSMKHHPDRHQGSDK 109 >SB_11933| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 40.3 bits (90), Expect = 0.001 Identities = 16/36 (44%), Positives = 25/36 (69%) Frame = +3 Query: 396 YEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEK 503 Y +LG+ P A+Q++IK +Y K S+ HPD+ G +K Sbjct: 74 YNVLGVSPKASQSKIKDAYYKLSMKHHPDRHQGSDK 109 >SB_3343| Best HMM Match : DnaJ (HMM E-Value=0.067) Length = 29 Score = 39.9 bits (89), Expect = 0.002 Identities = 15/28 (53%), Positives = 23/28 (82%) Frame = +3 Query: 402 ILGLPPGATQAEIKKSYRKQSLVLHPDK 485 ILG+PP A+ +IK+ YRK ++++HPDK Sbjct: 2 ILGVPPEASDDDIKRQYRKLAVLIHPDK 29 >SB_59454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 285 Score = 39.5 bits (88), Expect = 0.002 Identities = 16/35 (45%), Positives = 26/35 (74%) Frame = +3 Query: 390 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDKETG 494 D Y+IL + A++ EIKK+Y+K++L HPD+ +G Sbjct: 159 DYYKILNISKTASEDEIKKAYKKEALKHHPDRHSG 193 >SB_42340| Best HMM Match : DnaJ (HMM E-Value=3.2e-32) Length = 264 Score = 39.5 bits (88), Expect = 0.002 Identities = 16/35 (45%), Positives = 26/35 (74%) Frame = +3 Query: 390 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDKETG 494 D Y+IL + A++ EIKK+Y+K++L HPD+ +G Sbjct: 159 DYYKILNISKTASEDEIKKAYKKEALKHHPDRHSG 193 >SB_37512| Best HMM Match : DnaJ (HMM E-Value=1.3e-29) Length = 291 Score = 39.5 bits (88), Expect = 0.002 Identities = 17/37 (45%), Positives = 25/37 (67%) Frame = +3 Query: 396 YEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEKA 506 Y+ LG+ +T+ EI K+YRK++L HPDK + KA Sbjct: 9 YDTLGVHKDSTEKEILKAYRKKALKCHPDKNPDNPKA 45 >SB_21898| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1084 Score = 39.5 bits (88), Expect = 0.002 Identities = 17/31 (54%), Positives = 22/31 (70%) Frame = +3 Query: 390 DPYEILGLPPGATQAEIKKSYRKQSLVLHPD 482 D Y+ILG+PP A Q EIKK+Y + + HPD Sbjct: 59 DYYKILGVPPNANQKEIKKAYFELAKKYHPD 89 Score = 29.5 bits (63), Expect = 2.4 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = +2 Query: 500 EGFMRLTKAYQALTDDEARRNWEXYGNPDGPG 595 E F +++AY+ L+DD R+ ++ +G D G Sbjct: 98 EKFQEVSEAYEVLSDDGKRKAYDSFGQTDFSG 129 >SB_6887| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 875 Score = 39.5 bits (88), Expect = 0.002 Identities = 19/49 (38%), Positives = 30/49 (61%) Frame = +3 Query: 396 YEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEKAL*GSQRHTRLLQ 542 Y +LGL ATQ EIKK Y+K ++ HPD+ +++ +Q+H +Q Sbjct: 796 YRVLGLTEDATQEEIKKRYKKLAMKWHPDRHRDNKEE---AQKHFMEIQ 841 >SB_39063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 350 Score = 38.7 bits (86), Expect = 0.004 Identities = 15/30 (50%), Positives = 22/30 (73%) Frame = +3 Query: 396 YEILGLPPGATQAEIKKSYRKQSLVLHPDK 485 Y+ILG+ A+ E+KK+Y+KQ+ HPDK Sbjct: 6 YDILGVKKDASDQELKKAYKKQAFKYHPDK 35 >SB_56064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 711 Score = 38.7 bits (86), Expect = 0.004 Identities = 16/32 (50%), Positives = 23/32 (71%) Frame = +3 Query: 390 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDK 485 D YE+ G+ AT EI+K+++K +L LHPDK Sbjct: 28 DYYELFGISRDATSKEIRKAFKKLALRLHPDK 59 >SB_21411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 38.7 bits (86), Expect = 0.004 Identities = 17/38 (44%), Positives = 24/38 (63%) Frame = +3 Query: 390 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEK 503 D Y+ILGL + EI K+YRK ++ HPD G++K Sbjct: 208 DYYKILGLKRNCNKREITKAYRKLAVKWHPDNYKGEDK 245 >SB_21966| Best HMM Match : DnaJ (HMM E-Value=5.30001e-40) Length = 351 Score = 37.9 bits (84), Expect = 0.007 Identities = 16/32 (50%), Positives = 22/32 (68%) Frame = +3 Query: 390 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDK 485 D Y +L + A+ +IKK+YRKQ+L HPDK Sbjct: 4 DYYAVLNVDKAASADDIKKAYRKQALKYHPDK 35 >SB_48086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1353 Score = 36.3 bits (80), Expect = 0.021 Identities = 16/45 (35%), Positives = 24/45 (53%) Frame = +3 Query: 369 DYEMSNFDPYEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEK 503 D D Y +L + A + E+K +YR+ ++ HPDK T EK Sbjct: 124 DESEDEVDYYAVLAVRKEANEDELKAAYRRLCVLYHPDKHTDPEK 168 >SB_2302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 445 Score = 35.1 bits (77), Expect = 0.049 Identities = 15/35 (42%), Positives = 22/35 (62%) Frame = +3 Query: 396 YEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDE 500 Y+++ L P ATQ EIK +Y + S + HPD + E Sbjct: 53 YDVMKLLPTATQREIKSAYYELSRIYHPDLNSSAE 87 >SB_13439| Best HMM Match : DnaJ (HMM E-Value=5.9e-24) Length = 565 Score = 35.1 bits (77), Expect = 0.049 Identities = 15/35 (42%), Positives = 22/35 (62%) Frame = +3 Query: 396 YEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDE 500 Y+++ L P ATQ EIK +Y + S + HPD + E Sbjct: 200 YDVMKLLPTATQREIKSAYYELSRIYHPDLNSSAE 234 >SB_58160| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 34.7 bits (76), Expect = 0.065 Identities = 15/34 (44%), Positives = 21/34 (61%) Frame = +3 Query: 396 YEILGLPPGATQAEIKKSYRKQSLVLHPDKETGD 497 YEIL +P A+Q EIK ++ K++ HPD D Sbjct: 10 YEILDVPKDASQTEIKSAFIKKTKEFHPDVNPDD 43 >SB_2261| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 572 Score = 34.7 bits (76), Expect = 0.065 Identities = 14/30 (46%), Positives = 20/30 (66%) Frame = +3 Query: 396 YEILGLPPGATQAEIKKSYRKQSLVLHPDK 485 YE+LG+ + +KK+YRK +L HPDK Sbjct: 6 YEVLGVERDVDDSALKKTYRKLALKWHPDK 35 >SB_45438| Best HMM Match : DnaJ (HMM E-Value=4.4e-26) Length = 211 Score = 34.7 bits (76), Expect = 0.065 Identities = 15/34 (44%), Positives = 21/34 (61%) Frame = +3 Query: 396 YEILGLPPGATQAEIKKSYRKQSLVLHPDKETGD 497 YEIL +P A+Q EIK ++ K++ HPD D Sbjct: 71 YEILDVPKDASQTEIKSAFIKKTKEFHPDVNPDD 104 >SB_13154| Best HMM Match : DnaJ (HMM E-Value=7.9e-11) Length = 340 Score = 32.3 bits (70), Expect = 0.34 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = +3 Query: 372 YEMSNFDPYEILGLPPGATQAEIKKSYRKQSLVLHPDKETGD 497 YE+ D L + +KK+ RKQ L+ HPDK GD Sbjct: 133 YEILGLDMKTARKLSKDELKKTLKKACRKQLLIWHPDKNGGD 174 >SB_29448| Best HMM Match : DnaJ (HMM E-Value=0.00022) Length = 118 Score = 32.3 bits (70), Expect = 0.34 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +3 Query: 396 YEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDE 500 Y+++ L P AT EIK +Y + S + HPD + E Sbjct: 77 YDVMKLLPTATLREIKSAYYELSRIYHPDLNSSAE 111 >SB_24982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 533 Score = 32.3 bits (70), Expect = 0.34 Identities = 12/21 (57%), Positives = 17/21 (80%) Frame = +3 Query: 435 EIKKSYRKQSLVLHPDKETGD 497 ++KK+YRK L +HPDK TG+ Sbjct: 484 DVKKAYRKAVLCVHPDKLTGE 504 >SB_15221| Best HMM Match : ASC (HMM E-Value=0.0016) Length = 490 Score = 30.7 bits (66), Expect = 1.1 Identities = 22/77 (28%), Positives = 35/77 (45%), Gaps = 1/77 (1%) Frame = -3 Query: 639 LFDNPTR*SDAKAHAPGPSGLPYXSQLRLASSSVRAWYA-FVSLIKPSRHQFLCQDAKLE 463 LF P+ S + + AP P P S +SSS + A F+ +K + L +A Sbjct: 206 LFIKPSSSSSSPSSAPSPQPPPPSSSSSSSSSSSSVFIAHFLDELKEDKGFVLPANADAR 265 Query: 462 TVYDMISLFQPELHQEV 412 + + +F EL+ EV Sbjct: 266 AYFVKLQIFYEELNHEV 282 >SB_29418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 427 Score = 28.7 bits (61), Expect = 4.2 Identities = 20/83 (24%), Positives = 37/83 (44%), Gaps = 1/83 (1%) Frame = -3 Query: 573 YXSQLRLASSSVRAWYAFVSLIKPSRHQFLCQDAKLETVYDMISLFQPELHQEVGP-KFH 397 Y L + ++++ ++ P+ H F ++ + DMI+++ P LH P K Sbjct: 152 YIPNLHTCAITIKSIPDMTTIYTPNLHTFAIP---IQFILDMITIYTPNLHTCAIPIKSI 208 Query: 396 TDQSLTSHNQTVRPCMPEIQVAP 328 TD + T + + C IQ P Sbjct: 209 TDMT-TIYTPNLHTCAIPIQFIP 230 >SB_16586| Best HMM Match : DnaJ (HMM E-Value=4.9e-10) Length = 141 Score = 28.7 bits (61), Expect = 4.2 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +3 Query: 390 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDK 485 D +LG+ P IK++YRK HPDK Sbjct: 75 DACNVLGVKPTDDATTIKRAYRKLMSEHHPDK 106 >SB_47290| Best HMM Match : Ank (HMM E-Value=5.4e-29) Length = 445 Score = 27.9 bits (59), Expect = 7.4 Identities = 14/49 (28%), Positives = 25/49 (51%) Frame = +3 Query: 351 YKVSQFDYEMSNFDPYEILGLPPGATQAEIKKSYRKQSLVLHPDKETGD 497 +K+ E+ +F Y +L AT +I ++K++ HPDK+ D Sbjct: 277 FKIVTKTEELEDF--YSLLDCGEYATNEQINTEFKKKAKEWHPDKKRND 323 >SB_56512| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 1219 Score = 27.5 bits (58), Expect = 9.8 Identities = 12/36 (33%), Positives = 19/36 (52%), Gaps = 2/36 (5%) Frame = +1 Query: 325 DGCYLDF--WHTRSHSLIMRCQTLIRMKFWAYLLVQ 426 DG +LD+ W HSL RC + K +++ +Q Sbjct: 91 DGHFLDWYKWKESIHSLACRCSAAAKKKGYSFFAIQ 126 >SB_21236| Best HMM Match : Toxin_8 (HMM E-Value=10) Length = 173 Score = 27.5 bits (58), Expect = 9.8 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +3 Query: 396 YEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDE 500 YE P ++ ++ Y++ L LHP KET +E Sbjct: 139 YEKFESRPQTSRKPVENLYQRYILTLHPCKETNNE 173 >SB_11571| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 469 Score = 27.5 bits (58), Expect = 9.8 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +2 Query: 509 MRLTKAYQALTDDEARRNWEXYGN 580 ++ T AY A+ +DE NWE + + Sbjct: 198 LQATNAYSAMLEDEQPNNWETFAH 221 >SB_17384| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 425 Score = 27.5 bits (58), Expect = 9.8 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +1 Query: 196 KEDPAKLAERCQCPNCVSKH 255 KE P + AE CQ PN ++ H Sbjct: 201 KEGPTEKAESCQSPNMLTNH 220 >SB_2148| Best HMM Match : WSC (HMM E-Value=0.039) Length = 159 Score = 27.5 bits (58), Expect = 9.8 Identities = 12/36 (33%), Positives = 19/36 (52%), Gaps = 2/36 (5%) Frame = +1 Query: 325 DGCYLDF--WHTRSHSLIMRCQTLIRMKFWAYLLVQ 426 DG +LD+ W HSL RC + K +++ +Q Sbjct: 54 DGHFLDWYKWKESIHSLACRCSAAAKKKGYSFFAIQ 89 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,429,957 Number of Sequences: 59808 Number of extensions: 392960 Number of successful extensions: 783 Number of sequences better than 10.0: 45 Number of HSP's better than 10.0 without gapping: 721 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 782 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1620947750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -