BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060712.seq (639 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC006624-8|AAF39782.2| 1092|Caenorhabditis elegans Importin beta... 46 2e-05 AL032646-5|CAA21682.1| 1798|Caenorhabditis elegans Hypothetical ... 27 8.6 AF016687-11|ABL01528.1| 646|Caenorhabditis elegans Hypothetical... 27 8.6 >AC006624-8|AAF39782.2| 1092|Caenorhabditis elegans Importin beta family protein 3 protein. Length = 1092 Score = 46.0 bits (104), Expect = 2e-05 Identities = 31/134 (23%), Positives = 61/134 (45%) Frame = +3 Query: 231 LTKKGL*CVSELARNHIDDDGNNQWPEFLQFMFTCASAQDPNIKEAGIRMFTSVPGVFGN 410 + KK +SE+A N IDD G+ W L+ M C ++D + + P +FGN Sbjct: 100 IKKKIADLISEIASNLIDDSGDMTWGGVLELMDHCLKSEDLTGNYIALLILRGCPIIFGN 159 Query: 411 RQTENLDVIKGMLISALQPNESMALRTQGS*S*GAFILLHDKEPIIQKHFSDVLLPLMQV 590 R L +K +++ + ++ + AF + +D+E + + + ++ ++QV Sbjct: 160 RLAHFLPTLK-VVLEKCMATPDLQIKATAVRAVIAFAVDNDEEKDVVRLMTSLVPNVLQV 218 Query: 591 IVLSIEAADDDSAL 632 + + D D L Sbjct: 219 CNETSDEDDSDGPL 232 >AL032646-5|CAA21682.1| 1798|Caenorhabditis elegans Hypothetical protein Y54E2A.6 protein. Length = 1798 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/28 (42%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Frame = +1 Query: 352 QTSKKLVLE-CLRLYQVYLEIVRLKTWM 432 +T K VL+ C+R+ Q E+ RLK W+ Sbjct: 1546 RTDLKSVLDQCIRILQAMREMARLKNWL 1573 >AF016687-11|ABL01528.1| 646|Caenorhabditis elegans Hypothetical protein T21D12.7 protein. Length = 646 Score = 27.5 bits (58), Expect = 8.6 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = -1 Query: 504 FNCPEFAKPLIHLAAKQILTCLLSHP 427 F+CP+ A P + + Q TCL S+P Sbjct: 492 FSCPDGASPFLDPNSGQPATCLASNP 517 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,736,223 Number of Sequences: 27780 Number of extensions: 308509 Number of successful extensions: 838 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 795 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 838 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1416829972 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -