BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060707.seq (644 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 22 5.0 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 21 6.6 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 21 6.6 AM712902-1|CAN84641.1| 95|Tribolium castaneum hypothetical pro... 21 6.6 AM292360-1|CAL23172.2| 427|Tribolium castaneum gustatory recept... 21 6.6 AM292331-1|CAL23143.2| 437|Tribolium castaneum gustatory recept... 21 6.6 EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive pep... 21 8.7 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 21.8 bits (44), Expect = 5.0 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = -1 Query: 302 GNIVLASFELPESNIDVIP 246 GNI + + +P NI+ +P Sbjct: 151 GNIAMELWNMPRENIEPLP 169 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 21.4 bits (43), Expect = 6.6 Identities = 8/28 (28%), Positives = 13/28 (46%) Frame = -1 Query: 638 CCLRAIQKWARKRQQLGCSQSS*CMRIL 555 CC A+ RQ + S+ C+R + Sbjct: 615 CCYHAVAPGTDIRQSIALSRKKKCIRYM 642 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 21.4 bits (43), Expect = 6.6 Identities = 8/28 (28%), Positives = 13/28 (46%) Frame = -1 Query: 638 CCLRAIQKWARKRQQLGCSQSS*CMRIL 555 CC A+ RQ + S+ C+R + Sbjct: 507 CCYHAVAPGTDIRQSIALSRKKKCIRYM 534 >AM712902-1|CAN84641.1| 95|Tribolium castaneum hypothetical protein protein. Length = 95 Score = 21.4 bits (43), Expect = 6.6 Identities = 20/76 (26%), Positives = 32/76 (42%), Gaps = 1/76 (1%) Frame = +2 Query: 2 GTSTQFVIRD*PKMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQ 181 G +TQ V +G ++ H++ VIG + SG T Y KR +F+ + Sbjct: 21 GQNTQRVQNQPLVIGCDEKHVSPHVIGGITSGGPIPTKSSKYPI----KRKRVRFQTRVK 76 Query: 182 -EMGKGSFKYAWVLDK 226 + G S + W K Sbjct: 77 VQEGSKSGRNKWFFQK 92 >AM292360-1|CAL23172.2| 427|Tribolium castaneum gustatory receptor candidate 39 protein. Length = 427 Score = 21.4 bits (43), Expect = 6.6 Identities = 9/28 (32%), Positives = 16/28 (57%) Frame = -3 Query: 570 MYEDTSFLISSNLGSLYGGSVNPFCLLL 487 ++ D S ++ LG Y G + +CLL+ Sbjct: 262 LWVDLSHMMQQ-LGKAYSGMYSMYCLLI 288 >AM292331-1|CAL23143.2| 437|Tribolium castaneum gustatory receptor candidate 10 protein. Length = 437 Score = 21.4 bits (43), Expect = 6.6 Identities = 9/28 (32%), Positives = 16/28 (57%) Frame = -3 Query: 570 MYEDTSFLISSNLGSLYGGSVNPFCLLL 487 ++ D S ++ LG Y G + +CLL+ Sbjct: 262 LWVDLSHMMQQ-LGKAYSGMYSMYCLLI 288 >EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive peptide receptor 2 protein. Length = 354 Score = 21.0 bits (42), Expect = 8.7 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +2 Query: 323 QRFHQEHDHRNLS 361 + FH+EHD R S Sbjct: 260 RHFHEEHDTRRAS 272 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,096 Number of Sequences: 336 Number of extensions: 3204 Number of successful extensions: 8 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16552695 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -