BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060701.seq (601 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_01_0281 + 2160480-2162003 29 2.2 05_03_0042 - 7675244-7675846,7675946-7676101,7676444-7676511,768... 27 8.7 >03_01_0281 + 2160480-2162003 Length = 507 Score = 29.5 bits (63), Expect = 2.2 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = -3 Query: 125 LTSQILYEYVDVDNITSFDLRRNCDPDYKRPLTHMH 18 + S+IL E V+ IT+ D DPD RPL ++H Sbjct: 326 VVSKILEELDSVNGITTPDGMVTFDPDELRPLVYLH 361 >05_03_0042 - 7675244-7675846,7675946-7676101,7676444-7676511, 7680128-7680383 Length = 360 Score = 27.5 bits (58), Expect = 8.7 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -3 Query: 125 LTSQILYEYVDVDNITSFDLRRNCDPD 45 +T+Q+L DV+ I F + N DPD Sbjct: 113 VTTQLLLTLFDVEGIVHFGIAGNADPD 139 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,045,574 Number of Sequences: 37544 Number of extensions: 243452 Number of successful extensions: 341 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 339 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 341 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1435654836 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -