BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060701.seq (601 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. 23 2.3 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 22 5.3 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 22 5.3 U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive o... 21 7.0 AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin ... 21 7.0 >DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. Length = 471 Score = 23.0 bits (47), Expect = 2.3 Identities = 12/42 (28%), Positives = 18/42 (42%) Frame = -1 Query: 499 DININLMHENIXAVFFFLIHKHKTTVTSLITIAISFEILFLR 374 + N+NL+ F +H V +I I F + FLR Sbjct: 33 EANVNLLKNRTGRYMFTYLHLLYQDVHVMIWIGFGFLMTFLR 74 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 21.8 bits (44), Expect = 5.3 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = +3 Query: 60 PTEVETGNIINIHIFIQNL 116 PT+ T ++ H+F+ NL Sbjct: 906 PTKRRTMKVVKYHLFLTNL 924 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 21.8 bits (44), Expect = 5.3 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = +3 Query: 60 PTEVETGNIINIHIFIQNL 116 PT+ T ++ H+F+ NL Sbjct: 944 PTKRRTMKVVKYHLFLTNL 962 >U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive opsin protein. Length = 377 Score = 21.4 bits (43), Expect = 7.0 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -1 Query: 406 IAISFEILFLRFLLSSIRGTE 344 I + F ILF LLSSIR E Sbjct: 231 IPLIFIILFYSRLLSSIRNHE 251 >AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin protein. Length = 377 Score = 21.4 bits (43), Expect = 7.0 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -1 Query: 406 IAISFEILFLRFLLSSIRGTE 344 I + F ILF LLSSIR E Sbjct: 231 IPLIFIILFYSRLLSSIRNHE 251 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 166,200 Number of Sequences: 438 Number of extensions: 3450 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17604432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -