BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060693.seq (642 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicas... 42 4e-06 AM292371-1|CAL23183.2| 350|Tribolium castaneum gustatory recept... 21 8.6 >AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicase protein. Length = 580 Score = 41.9 bits (94), Expect = 4e-06 Identities = 20/52 (38%), Positives = 29/52 (55%) Frame = +3 Query: 357 EVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGR 512 EV V+G + PI FE + ++ + VK GY +PT IQ P+ +SGR Sbjct: 145 EVKVTGNDAPPPITSFETSGLRPHLLENVKKSGYTKPTAIQKYAIPVILSGR 196 Score = 23.0 bits (47), Expect = 2.1 Identities = 9/12 (75%), Positives = 11/12 (91%) Frame = +1 Query: 529 QTGSGKTLAYIL 564 QTGSGKT A++L Sbjct: 203 QTGSGKTAAFML 214 >AM292371-1|CAL23183.2| 350|Tribolium castaneum gustatory receptor candidate 50 protein. Length = 350 Score = 21.0 bits (42), Expect = 8.6 Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = -1 Query: 102 AIIPVTRHD*FSDLVEDVYL-NYGFFLTQGPPLV 4 A++PV +H LV VYL ++ L+ G +V Sbjct: 18 ALLPVKKHHRLEKLVPCVYLTSFSVVLSLGSFIV 51 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 139,507 Number of Sequences: 336 Number of extensions: 2987 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16448590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -