BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060693.seq (642 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 7e-14 SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) 61 9e-10 SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) 57 1e-08 SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) 50 1e-06 SB_46680| Best HMM Match : Helicase_C (HMM E-Value=3.8e-22) 48 5e-06 SB_43842| Best HMM Match : RNB (HMM E-Value=0) 47 1e-05 SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) 42 3e-04 SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_52320| Best HMM Match : DEAD (HMM E-Value=0) 32 0.46 SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.80 SB_49218| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_17563| Best HMM Match : DEAD (HMM E-Value=0) 31 1.1 SB_2247| Best HMM Match : DEAD (HMM E-Value=0) 31 1.1 SB_6554| Best HMM Match : Isy1 (HMM E-Value=0) 30 1.8 SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) 29 2.4 SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) 29 3.2 SB_19645| Best HMM Match : Smr (HMM E-Value=8.2) 28 5.6 SB_19782| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_8125| Best HMM Match : MFS_1 (HMM E-Value=3.2e-07) 28 7.4 SB_50950| Best HMM Match : AAA_5 (HMM E-Value=0.0006) 28 7.4 >SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 790 Score = 74.5 bits (175), Expect = 7e-14 Identities = 32/89 (35%), Positives = 48/89 (53%) Frame = +3 Query: 246 PRLDSVSLQPFNKNFYDPHPTVLKRSPYEVEEYRNNHEVTVSGVEVHNPIQYFEEANFPD 425 P + +PFNKNFY+ HP + K+S E+++ R + VSG P F F + Sbjct: 467 PEKSKIDYKPFNKNFYEEHPEITKQSKQEIDDLRKKMGIKVSGAMPARPCISFAHFGFDE 526 Query: 426 YVQQGVKTMGYKEPTPIQAQGWPIAMSGR 512 + ++ + Y +PT IQ Q PIA+SGR Sbjct: 527 QMMASIRKLEYTQPTQIQCQALPIALSGR 555 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/44 (38%), Positives = 27/44 (61%) Frame = +2 Query: 509 KNLVGVLKRVPAKRWPTSXPAIVHINNQPPIRRXDGPIALVLAP 640 ++++G+ K K PA+VHI +QP ++ DGPI L+ AP Sbjct: 555 RDIIGIAKTGSGKTAAFLWPALVHIMDQPELQVGDGPIVLICAP 598 >SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) Length = 690 Score = 60.9 bits (141), Expect = 9e-10 Identities = 27/56 (48%), Positives = 37/56 (66%) Frame = +3 Query: 318 RSPYEVEEYRNNHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQ 485 R +EV+ YR + ++TV+G V P+ FEE+ FPDY+Q K G+ EPT IQAQ Sbjct: 57 RGQHEVDAYRRSKDLTVNGRNVPKPVTTFEESAFPDYIQSYFKREGFTEPTMIQAQ 112 Score = 38.3 bits (85), Expect = 0.005 Identities = 16/25 (64%), Positives = 19/25 (76%) Frame = +2 Query: 566 PAIVHINNQPPIRRXDGPIALVLAP 640 P IVHIN+QP ++ DGPI LVL P Sbjct: 116 PGIVHINHQPLLQPGDGPIVLVLCP 140 >SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 592 Score = 60.1 bits (139), Expect = 2e-09 Identities = 31/86 (36%), Positives = 48/86 (55%), Gaps = 1/86 (1%) Frame = +3 Query: 258 SVSLQPFNKNFYDPHPTVLKRSPYEVEEYRNNHE-VTVSGVEVHNPIQYFEEANFPDYVQ 434 +V QPF K+FY P + K +P E +E+R + E + V G P++ + + + Sbjct: 58 TVVYQPFRKDFYVEVPELAKMTPEETDEFRLSLENIHVRGKNAPKPVKTWAQTGVQLKIL 117 Query: 435 QGVKTMGYKEPTPIQAQGWPIAMSGR 512 +K Y++PTPIQAQ P+ MSGR Sbjct: 118 DVLKKNSYEKPTPIQAQAIPVIMSGR 143 >SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) Length = 500 Score = 56.8 bits (131), Expect = 1e-08 Identities = 25/74 (33%), Positives = 41/74 (55%) Frame = +3 Query: 291 YDPHPTVLKRSPYEVEEYRNNHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPT 470 Y HPT+ + +V++ R+ E+ V G V +P+ F +F + + + + GY PT Sbjct: 161 YKEHPTIAALTAEQVKQLRDKMEIKVKGEHVVSPVLEFFHCSFNESLSKNLSNHGYHSPT 220 Query: 471 PIQAQGWPIAMSGR 512 PIQ Q P+ +SGR Sbjct: 221 PIQMQVLPVLLSGR 234 >SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) Length = 428 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/57 (36%), Positives = 34/57 (59%) Frame = +3 Query: 342 YRNNHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGR 512 +R + ++ G + PI+ ++EA PD + + V +GYK+PTPIQ Q PI + R Sbjct: 83 FREDFNISTKGGRIPFPIRKWKEAQIPDSILEIVDKLGYKDPTPIQRQAIPIGLQNR 139 >SB_46680| Best HMM Match : Helicase_C (HMM E-Value=3.8e-22) Length = 1058 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/64 (34%), Positives = 34/64 (53%), Gaps = 4/64 (6%) Frame = +3 Query: 330 EVEEYRNNHEVTVSGVEVHNPIQYF----EEANFPDYVQQGVKTMGYKEPTPIQAQGWPI 497 ++ +R+ + V G +V +P++ F E FPDY+ V+ GY PTPIQ Q P+ Sbjct: 137 KINLFRHEQHIYVKGADVPDPVETFSQLIERYGFPDYIIHNVQERGYTTPTPIQMQATPL 196 Query: 498 AMSG 509 G Sbjct: 197 MAHG 200 >SB_43842| Best HMM Match : RNB (HMM E-Value=0) Length = 1238 Score = 47.2 bits (107), Expect = 1e-05 Identities = 24/79 (30%), Positives = 39/79 (49%) Frame = +3 Query: 276 FNKNFYDPHPTVLKRSPYEVEEYRNNHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMG 455 F ++YD + V + S V+E R + + + G + PI+ F + N P + + Sbjct: 32 FMWSYYDENEKVSRLSDEVVDEIRWKNGIHIEGEDCPKPIESFHDLNLPPELSTYLAKKN 91 Query: 456 YKEPTPIQAQGWPIAMSGR 512 ++ PTPIQ Q MSGR Sbjct: 92 FQVPTPIQMQSLSCVMSGR 110 >SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 42.3 bits (95), Expect = 3e-04 Identities = 22/52 (42%), Positives = 28/52 (53%) Frame = +3 Query: 357 EVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGR 512 EV VSG I FEEAN + V+ YK+PTP+Q PI ++GR Sbjct: 698 EVLVSGNNPVRHINSFEEANLYEAFLNNVRKAQYKKPTPVQKYSIPIVIAGR 749 >SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) Length = 185 Score = 42.3 bits (95), Expect = 3e-04 Identities = 22/52 (42%), Positives = 28/52 (53%) Frame = +3 Query: 357 EVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGR 512 EV VSG I FEEAN + V+ YK+PTP+Q PI ++GR Sbjct: 121 EVLVSGNNPVRHINSFEEANLYEAFLNNVRKAQYKKPTPVQKYSIPIVIAGR 172 >SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 797 Score = 38.7 bits (86), Expect = 0.004 Identities = 18/49 (36%), Positives = 24/49 (48%) Frame = +3 Query: 366 VSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGR 512 VSG I F E F + + + GY+ PTP+Q PI M+GR Sbjct: 469 VSGENQPPKITSFNELPFGEQLMANISRAGYRRPTPVQKAALPIVMAGR 517 >SB_52320| Best HMM Match : DEAD (HMM E-Value=0) Length = 340 Score = 31.9 bits (69), Expect = 0.46 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = +3 Query: 393 IQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGR 512 ++ F + G+ G+ PT IQ QG P+A+SGR Sbjct: 49 VEKFSDFPISKRTLDGLMKAGFVTPTDIQKQGIPVALSGR 88 >SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1375 Score = 31.1 bits (67), Expect = 0.80 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = +3 Query: 393 IQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGR 512 I FE+ + + + V GYK+PTP+Q PI R Sbjct: 874 ILQFEDVDLGEILLHNVGLAGYKKPTPVQKYAIPIVKGKR 913 >SB_49218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 480 Score = 30.7 bits (66), Expect = 1.1 Identities = 11/38 (28%), Positives = 17/38 (44%) Frame = +3 Query: 378 EVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGW 491 ++H P++ + FP Y + Y P P QA W Sbjct: 6 DIHGPVRKLHKHGFPGYEEDYAAVFKYPTPWPEQAMEW 43 >SB_17563| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 30.7 bits (66), Expect = 1.1 Identities = 14/41 (34%), Positives = 24/41 (58%) Frame = +3 Query: 402 FEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGRI*LA 524 FE+ + G+ G+ +P+PIQ + P+A++GR LA Sbjct: 49 FEDYCLKRELLMGIFEKGFDKPSPIQEESIPVALAGRDILA 89 >SB_2247| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 30.7 bits (66), Expect = 1.1 Identities = 14/41 (34%), Positives = 24/41 (58%) Frame = +3 Query: 402 FEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGRI*LA 524 FE+ + G+ G+ +P+PIQ + P+A++GR LA Sbjct: 49 FEDYCLKRELLMGIFEKGFDKPSPIQEESIPVALAGRDILA 89 >SB_6554| Best HMM Match : Isy1 (HMM E-Value=0) Length = 675 Score = 29.9 bits (64), Expect = 1.8 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 2/49 (4%) Frame = +3 Query: 288 FYDPHPTVLKRSPYEVEEYRNN--HEVTVSGVEVHNPIQYFEEANFPDY 428 + D VL E EE NN H++ + + +HNP YFE+ + DY Sbjct: 217 YRDEDDGVLVPIEQEAEEEVNNKLHKILIVNM-IHNPFNYFEKKSPTDY 264 >SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) Length = 96 Score = 29.5 bits (63), Expect = 2.4 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +3 Query: 435 QGVKTMGYKEPTPIQAQGWPIAMSGR 512 + V +G+ PTPIQA P+A+ G+ Sbjct: 23 RAVNELGFLHPTPIQASTIPVALMGK 48 >SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) Length = 490 Score = 29.1 bits (62), Expect = 3.2 Identities = 16/54 (29%), Positives = 29/54 (53%), Gaps = 3/54 (5%) Frame = +3 Query: 354 HEVTVSGVEVHNPI---QYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMS 506 HEV V + +P+ + FEE +++GV MG+ +P+ IQ P+ ++ Sbjct: 86 HEVEVLRSDPSSPLYSAKSFEELPLSANLRRGVYDMGFNKPSKIQETALPMLLA 139 >SB_19645| Best HMM Match : Smr (HMM E-Value=8.2) Length = 346 Score = 28.3 bits (60), Expect = 5.6 Identities = 31/97 (31%), Positives = 40/97 (41%), Gaps = 11/97 (11%) Frame = +3 Query: 231 SEHASPRLDSVSLQPFNKNFYDPHPTVLKRSPYEVEEYRNNHEVTVSGVEVHNPIQ---- 398 SE AS S SLQ N N DP L R+ + R +VT ++ P Q Sbjct: 239 SEGASLMKLSTSLQSLNTNIKDPRAAFLNRTKIKDLLVRTITKVTFLQQQIAQPRQLTLT 298 Query: 399 -YFEEANFPDYV----QQG--VKTMGYKEPTPIQAQG 488 YF E + DYV Q G + G P+P + G Sbjct: 299 KYF-ETDSSDYVVELLQDGSAANSKGSDTPSPASSGG 334 >SB_19782| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 728 Score = 27.9 bits (59), Expect = 7.4 Identities = 12/30 (40%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Frame = -3 Query: 238 CSDLQRILFSHQILQILQIYCHRC-QIETN 152 CS +L +IL+ +YC +C Q ETN Sbjct: 14 CSLCSEVLTEPKILRCFHVYCQKCLQAETN 43 >SB_8125| Best HMM Match : MFS_1 (HMM E-Value=3.2e-07) Length = 401 Score = 27.9 bits (59), Expect = 7.4 Identities = 12/28 (42%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = -3 Query: 169 CQIETNYRRICCLLQIWN-HRFHGYYSS 89 C + +YRR CC L +W H + Y+SS Sbjct: 218 CCVRVDYRRKCC-LHVWRVHTTNTYWSS 244 >SB_50950| Best HMM Match : AAA_5 (HMM E-Value=0.0006) Length = 1552 Score = 27.9 bits (59), Expect = 7.4 Identities = 16/39 (41%), Positives = 19/39 (48%) Frame = +1 Query: 430 CNKV*RQWVTKNRRLFKLKAGR*LCLEEFSWRTQTGSGK 546 CN+ R V K+RRL AGR L T +GS K Sbjct: 59 CNESGRMSVDKDRRLISTSAGRVTKLPPIGAPTSSGSNK 97 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,066,208 Number of Sequences: 59808 Number of extensions: 347924 Number of successful extensions: 934 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 876 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 933 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1620947750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -