BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060692.seq (636 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. 26 0.27 AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase prot... 23 2.5 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 23 2.5 DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein pr... 22 5.7 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 21 7.6 >AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. Length = 355 Score = 26.2 bits (55), Expect = 0.27 Identities = 14/40 (35%), Positives = 19/40 (47%) Frame = -3 Query: 310 FRKARVPCRTWTSPPGRGGVNGDTLKHLCWISESTTLVLL 191 F +A CR W P GRG + D L W +E L ++ Sbjct: 193 FLQAANACRFW--PTGRGIYHNDDKTFLVWCNEEDHLRII 230 >AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase protein. Length = 693 Score = 23.0 bits (47), Expect = 2.5 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = -3 Query: 496 VTLPFVQWRLAWPHGRDAGGDNLRRVQF 413 VT+PF + R GGD+L R F Sbjct: 551 VTIPFERTFRNLDENRPIGGDSLERFDF 578 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 23.0 bits (47), Expect = 2.5 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +2 Query: 362 PCLRKSYILTWMTPKDRKLNAAQVI 436 P L + +IL W KD + QVI Sbjct: 599 PSLDQVWILNWRNQKDIDVKTVQVI 623 >DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein protein. Length = 484 Score = 21.8 bits (44), Expect = 5.7 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +1 Query: 388 HLDDPKGQEIERGAS 432 H+DDP G GAS Sbjct: 333 HIDDPVGASATHGAS 347 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = -2 Query: 179 QNSHTVRHGRRTS 141 + H +RHGRR S Sbjct: 79 ETHHPIRHGRRQS 91 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 182,783 Number of Sequences: 438 Number of extensions: 3634 Number of successful extensions: 12 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19071468 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -