BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060690.seq (635 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC17A5.13 |||GTP cyclohydrolase |Schizosaccharomyces pombe|chr... 29 0.43 SPCC297.06c ||SPCC737.01c|mitochondrial ribosomal protein subuni... 25 9.1 >SPAC17A5.13 |||GTP cyclohydrolase |Schizosaccharomyces pombe|chr 1|||Manual Length = 235 Score = 29.5 bits (63), Expect = 0.43 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = -2 Query: 541 SIITKVPCVGVNPSHQTLLGTPDR 470 +I T + C+G +P Q LLGTP+R Sbjct: 58 AISTILECLGEDPERQGLLGTPER 81 >SPCC297.06c ||SPCC737.01c|mitochondrial ribosomal protein subunit 8|Schizosaccharomyces pombe|chr 3|||Manual Length = 230 Score = 25.0 bits (52), Expect = 9.1 Identities = 13/39 (33%), Positives = 19/39 (48%), Gaps = 4/39 (10%) Frame = -3 Query: 477 QTETTNEGKNDYIIQS----IRECDDPSVSSVWRHLVRR 373 Q E NE +Y+ + + CD SV +WR V+R Sbjct: 12 QKEMFNEIFKEYVKEEKQIDLGTCDQDSVHDLWRRFVKR 50 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,707,975 Number of Sequences: 5004 Number of extensions: 56415 Number of successful extensions: 129 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 124 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 129 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 283719918 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -