BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060690.seq (635 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 23 6.1 M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles ... 23 8.1 AY825724-1|AAV70287.1| 159|Anopheles gambiae subtilase serine p... 23 8.1 AY825711-1|AAV70274.1| 159|Anopheles gambiae subtilase serine p... 23 8.1 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 23.4 bits (48), Expect = 6.1 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +2 Query: 551 YWNVVVVLWRTITTTVWIPE 610 YW+ ++ L TIT +W P+ Sbjct: 141 YWSSMLNLDATITCGIWTPD 160 >M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 975 Score = 23.0 bits (47), Expect = 8.1 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = -1 Query: 440 LFKAYANVMTHPYPPSGGTLYAGALDILV 354 LF + N + + PP G LYA + I + Sbjct: 682 LFSLFINDVCNVLPPDGHLLYADDIKIFL 710 >AY825724-1|AAV70287.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.0 bits (47), Expect = 8.1 Identities = 11/40 (27%), Positives = 19/40 (47%) Frame = -3 Query: 459 EGKNDYIIQSIRECDDPSVSSVWRHLVRRCVRHLGTFITL 340 EG DY I + D + +V++ L++ HL + L Sbjct: 94 EGLRDYQTAQISKLDAENAENVYQALLKDNPNHLAAHLAL 133 >AY825711-1|AAV70274.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.0 bits (47), Expect = 8.1 Identities = 11/40 (27%), Positives = 19/40 (47%) Frame = -3 Query: 459 EGKNDYIIQSIRECDDPSVSSVWRHLVRRCVRHLGTFITL 340 EG DY I + D + +V++ L++ HL + L Sbjct: 94 EGLRDYQTAQISKLDAENAENVYQALLKDNPNHLAAHLAL 133 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 680,888 Number of Sequences: 2352 Number of extensions: 13598 Number of successful extensions: 68 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 68 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 68 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 62305095 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -