Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV060690.seq
         (635 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g16510.1 68416.m02107 C2 domain-containing protein contains s...    28   6.0  

>At3g16510.1 68416.m02107 C2 domain-containing protein contains
           similarity to shock protein SRC2 [Glycine max]
           gi|2055230|dbj|BAA19769 ; contains Pfam profile
           PF00168:C2 domain
          Length = 360

 Score = 27.9 bits (59), Expect = 6.0
 Identities = 13/31 (41%), Positives = 18/31 (58%)
 Frame = -2

Query: 628 PPTAATFRYPNRRSNGPPKNDNNIPIL*LSI 536
           PPT+  + Y    +  PPKN+NN P L L +
Sbjct: 303 PPTSPGYGYGCPTTQVPPKNNNNKPGLGLGL 333


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,664,887
Number of Sequences: 28952
Number of extensions: 279168
Number of successful extensions: 570
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 556
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 570
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1305036432
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)