BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060683.seq (638 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM712903-1|CAN84642.1| 148|Tribolium castaneum hypothetical pro... 24 1.2 EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 ... 22 3.8 DQ494421-1|ABF55372.1| 73|Tribolium castaneum telomerase rever... 21 8.7 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 21 8.7 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 21 8.7 >AM712903-1|CAN84642.1| 148|Tribolium castaneum hypothetical protein protein. Length = 148 Score = 23.8 bits (49), Expect = 1.2 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = -3 Query: 252 KTSVYDHHFTEIIFHPTS 199 +T VY H+F + IF+P + Sbjct: 126 ETDVYTHNFVKDIFYPAN 143 >EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 protein. Length = 493 Score = 22.2 bits (45), Expect = 3.8 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = +1 Query: 253 LVDFLEDTEKLRPAALFYFPAFVHFHRY*TVNK 351 LVDF + + F+ P+FV R V+K Sbjct: 204 LVDFKSVIRSISVFSFFFMPSFVDIFRLTFVDK 236 >DQ494421-1|ABF55372.1| 73|Tribolium castaneum telomerase reverse transcriptase protein. Length = 73 Score = 21.0 bits (42), Expect = 8.7 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = -1 Query: 287 RNFSVSSKKSTKKPQYMTTIL 225 +NF + K TKKP + +L Sbjct: 32 KNFRLCKKHKTKKPVQILALL 52 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 21.0 bits (42), Expect = 8.7 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = -1 Query: 287 RNFSVSSKKSTKKPQYMTTIL 225 +NF + K TKKP + +L Sbjct: 32 KNFRLCKKHKTKKPVQILALL 52 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 21.0 bits (42), Expect = 8.7 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -1 Query: 263 KSTKKPQYMTTILLRLYFIPHHLISF 186 ++TKK Q++ T R+ IP+ L F Sbjct: 293 RNTKKLQWLDTSHNRISEIPNDLFRF 318 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 141,369 Number of Sequences: 336 Number of extensions: 2981 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16501678 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -