BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060683.seq (638 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 24 3.5 AJ459962-1|CAD31061.1| 685|Anopheles gambiae prophenoloxidase 9... 23 6.2 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 24.2 bits (50), Expect = 3.5 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 416 TSLLAFPPKSPEPNEIILP 472 TS A PPKSP I LP Sbjct: 1130 TSSPALPPKSPTSQRITLP 1148 >AJ459962-1|CAD31061.1| 685|Anopheles gambiae prophenoloxidase 9 protein. Length = 685 Score = 23.4 bits (48), Expect = 6.2 Identities = 12/48 (25%), Positives = 21/48 (43%) Frame = +2 Query: 287 VQRLCFIFPPLCTFTDIKQLINHRYFTFKPEATLNRQNKTNHTTSLLA 430 V+R C P + ++++ I YF + LNR H +L+ Sbjct: 247 VERFCNRLPAVKPLKNLREPIPEAYFPKLLNSALNRTYPGRHANMVLS 294 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 601,733 Number of Sequences: 2352 Number of extensions: 11621 Number of successful extensions: 9 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 62723250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -