BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060683.seq (638 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81473-8|CAB03899.2| 418|Caenorhabditis elegans Hypothetical pr... 28 4.9 Z81473-4|CAB03891.1| 463|Caenorhabditis elegans Hypothetical pr... 28 4.9 AL031636-1|CAA21046.2| 418|Caenorhabditis elegans Hypothetical ... 28 4.9 >Z81473-8|CAB03899.2| 418|Caenorhabditis elegans Hypothetical protein Y47H9A.1 protein. Length = 418 Score = 28.3 bits (60), Expect = 4.9 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +2 Query: 317 LCTFTDIKQLINHRYFTFKPEATLNRQNKTN 409 L T + QL NHRYF FK E + + TN Sbjct: 69 LTTQNEPIQLGNHRYFAFKYEIVRGKYSHTN 99 >Z81473-4|CAB03891.1| 463|Caenorhabditis elegans Hypothetical protein C17D12.3 protein. Length = 463 Score = 28.3 bits (60), Expect = 4.9 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +2 Query: 317 LCTFTDIKQLINHRYFTFKPEATLNRQNKTN 409 L T + QL NHRYF FK E + + TN Sbjct: 69 LTTQNEPIQLGNHRYFAFKYEIVRGKYSHTN 99 >AL031636-1|CAA21046.2| 418|Caenorhabditis elegans Hypothetical protein Y47H9A.1 protein. Length = 418 Score = 28.3 bits (60), Expect = 4.9 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +2 Query: 317 LCTFTDIKQLINHRYFTFKPEATLNRQNKTN 409 L T + QL NHRYF FK E + + TN Sbjct: 69 LTTQNEPIQLGNHRYFAFKYEIVRGKYSHTN 99 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,415,961 Number of Sequences: 27780 Number of extensions: 262115 Number of successful extensions: 574 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 560 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 574 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1416829972 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -