BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060683.seq (638 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g07350.1 68417.m01129 hypothetical protein 28 6.0 At1g79110.2 68414.m09225 expressed protein 27 7.9 >At4g07350.1 68417.m01129 hypothetical protein Length = 330 Score = 27.9 bits (59), Expect = 6.0 Identities = 17/70 (24%), Positives = 33/70 (47%), Gaps = 6/70 (8%) Frame = +2 Query: 293 RLCFIFPPLCTFTDIKQLINHRYF------TFKPEATLNRQNKTNHTTSLLAFPPKSPEP 454 RL + PP+ + D+K+L+ ++Y + K T +N+ L+ P P P Sbjct: 142 RLYYKEPPITLWRDLKELLRNKYALQASNRSRKVSVTAQGENELVTNNVLIQNEPPDPTP 201 Query: 455 NEIILPLCST 484 +++ + ST Sbjct: 202 LPLVMMIPST 211 >At1g79110.2 68414.m09225 expressed protein Length = 355 Score = 27.5 bits (58), Expect = 7.9 Identities = 11/44 (25%), Positives = 25/44 (56%) Frame = +3 Query: 357 VISHLNLKQH*IDKIKLITQLHSSRSRQKVRNQMRLSSRSVLHS 488 + SH+N +QH ID+ LH R + ++ + + +R+++ + Sbjct: 145 ISSHMNQQQHEIDR---FVSLHMERVKYEIEEKRKRQARTIMEA 185 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,560,342 Number of Sequences: 28952 Number of extensions: 241578 Number of successful extensions: 504 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 497 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 504 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1314848736 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -