BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060680.seq (630 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 25 0.80 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 21 7.5 DQ468657-1|ABE02558.1| 322|Apis mellifera 1,4,5-trisphosphate r... 21 9.9 AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase prot... 21 9.9 AB006152-1|BAA24504.1| 178|Apis mellifera inositol 1,4,5-tripho... 21 9.9 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 24.6 bits (51), Expect = 0.80 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -2 Query: 455 NNNMGPTMGSVVHSHN 408 N+ MGPTMG H H+ Sbjct: 340 NHTMGPTMGPPHHHHH 355 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.4 bits (43), Expect = 7.5 Identities = 11/39 (28%), Positives = 18/39 (46%) Frame = -3 Query: 235 KVTIS*NTFSIYLKTKVAFVLNMNIAA*XSRNHPSRATF 119 K+T + T + AF++N N+ S+N R F Sbjct: 944 KLTKTSGTVQAQINPDFAFIVNSNLRLTFSKNVQGRVGF 982 >DQ468657-1|ABE02558.1| 322|Apis mellifera 1,4,5-trisphosphate receptor protein. Length = 322 Score = 21.0 bits (42), Expect = 9.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +1 Query: 535 KFNFIMHTKIKXVQ*VAFAGDVR 603 ++ +M TK+K ++ + F DVR Sbjct: 40 EYPLVMDTKLKIIEILQFILDVR 62 >AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase protein. Length = 693 Score = 21.0 bits (42), Expect = 9.9 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = -2 Query: 386 RWSCCMMFDCSQTQSVQFLYHNHRPIPNFQFP 291 R++C + C++ V+ + H PIP FP Sbjct: 244 RYNCERL--CNRLGRVKRFINWHEPIPEAYFP 273 >AB006152-1|BAA24504.1| 178|Apis mellifera inositol 1,4,5-triphosphate recepter protein. Length = 178 Score = 21.0 bits (42), Expect = 9.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +1 Query: 535 KFNFIMHTKIKXVQ*VAFAGDVR 603 ++ +M TK+K ++ + F DVR Sbjct: 8 EYPLVMDTKLKIIEILQFILDVR 30 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 159,364 Number of Sequences: 438 Number of extensions: 3146 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18826962 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -