BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060677.seq (631 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY081778-1|AAL91655.1| 507|Anopheles gambiae cytochrome P450 pr... 25 1.5 >AY081778-1|AAL91655.1| 507|Anopheles gambiae cytochrome P450 protein. Length = 507 Score = 25.4 bits (53), Expect = 1.5 Identities = 18/47 (38%), Positives = 27/47 (57%), Gaps = 1/47 (2%) Frame = +1 Query: 73 GINVNEHLSQVGGSLSAGSE*FSTTV-LLLYCDTQSCVLAGNIR*DI 210 G+ +NE +QV S AGSE STT+ LY ++ + G +R +I Sbjct: 295 GLTMNELAAQVFVSFLAGSETSSTTMNFCLYELAKNPDIQGRLREEI 341 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 645,038 Number of Sequences: 2352 Number of extensions: 12602 Number of successful extensions: 20 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 61468785 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -