BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060676.seq (630 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. 26 0.35 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 24 1.4 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 22 5.7 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 22 5.7 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 22 5.7 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 22 5.7 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 22 5.7 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 22 5.7 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 22 5.7 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 22 5.7 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 21 7.5 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 21 7.5 DQ435329-1|ABD92644.1| 150|Apis mellifera OBP12 protein. 21 7.5 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 21 7.5 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 21 7.5 DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 21 9.9 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 21 9.9 >AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. Length = 615 Score = 25.8 bits (54), Expect = 0.35 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +3 Query: 96 LLGDPCQTVYSSVNPDSS 149 ++G+PCQ V+SS PD S Sbjct: 51 VIGEPCQRVHSSRIPDLS 68 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 23.8 bits (49), Expect = 1.4 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = -1 Query: 516 MVSVKMTPERERVVATRVAETWTEATLESTKIWAGAWKVE 397 +V V++ E T + W+E+ +ES G W+VE Sbjct: 1192 VVDVRVHVPGESESETVLTLAWSESNVESKGRLLGFWRVE 1231 Score = 21.0 bits (42), Expect = 9.9 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +3 Query: 117 TVYSSVNPDSSNYRL 161 T Y +NPD+ N +L Sbjct: 1472 TTYPRINPDNHNEKL 1486 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 5.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -3 Query: 292 STSDKTFLRVRSRTPKNRARRRGSRWVQ 209 S S+ + +RSRT + R RRR +Q Sbjct: 18 SRSEDSETGLRSRTQEERLRRRREWMIQ 45 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 5.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -3 Query: 292 STSDKTFLRVRSRTPKNRARRRGSRWVQ 209 S S+ + +RSRT + R RRR +Q Sbjct: 18 SRSEDSETGLRSRTQEERLRRRREWMIQ 45 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 5.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -3 Query: 292 STSDKTFLRVRSRTPKNRARRRGSRWVQ 209 S S+ + +RSRT + R RRR +Q Sbjct: 18 SRSEDSETGLRSRTQEERLRRRREWMIQ 45 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 5.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -3 Query: 292 STSDKTFLRVRSRTPKNRARRRGSRWVQ 209 S S+ + +RSRT + R RRR +Q Sbjct: 18 SRSEDSETGLRSRTQEERLRRRREWMIQ 45 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 5.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -3 Query: 292 STSDKTFLRVRSRTPKNRARRRGSRWVQ 209 S S+ + +RSRT + R RRR +Q Sbjct: 18 SRSEDSETGLRSRTQEERLRRRREWMIQ 45 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 5.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -3 Query: 292 STSDKTFLRVRSRTPKNRARRRGSRWVQ 209 S S+ + +RSRT + R RRR +Q Sbjct: 18 SRSEDSETGLRSRTQEERLRRRREWMIQ 45 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 21.8 bits (44), Expect = 5.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -3 Query: 292 STSDKTFLRVRSRTPKNRARRRGSRWVQ 209 S S+ + +RSRT + R RRR +Q Sbjct: 18 SRSEDSETGLRSRTQEERLRRRREWMIQ 45 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 21.8 bits (44), Expect = 5.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -3 Query: 292 STSDKTFLRVRSRTPKNRARRRGSRWVQ 209 S S+ + +RSRT + R RRR +Q Sbjct: 18 SRSEDSETGLRSRTQEERLRRRREWMIQ 45 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 21.4 bits (43), Expect = 7.5 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -2 Query: 608 SFANVLRKLKGWSLSIASKSGAVP 537 S + RK+ G++L ASK VP Sbjct: 380 SIDTLARKILGYNLEAASKYQIVP 403 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 21.4 bits (43), Expect = 7.5 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -2 Query: 608 SFANVLRKLKGWSLSIASKSGAVP 537 S + RK+ G++L ASK VP Sbjct: 380 SIDTLARKILGYNLEAASKYQIVP 403 >DQ435329-1|ABD92644.1| 150|Apis mellifera OBP12 protein. Length = 150 Score = 21.4 bits (43), Expect = 7.5 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +2 Query: 470 VATTRSRSGVIFTETIDCSNQGLVRRHSLR 559 V R+RS IF + DC ++ + H L+ Sbjct: 17 VQNLRARSVNIFQDIADCVDRSNMTFHELK 46 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.4 bits (43), Expect = 7.5 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = +3 Query: 105 DPCQTVYSSVNPDSSNYRLLSEVEHLKPYRDFYCHWT 215 DP Q +S +SSN +++H++ DF H T Sbjct: 1788 DPDQL--TSSRTESSNQLDAGKLKHIRAVSDFIYHGT 1822 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.4 bits (43), Expect = 7.5 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = +3 Query: 105 DPCQTVYSSVNPDSSNYRLLSEVEHLKPYRDFYCHWT 215 DP Q +S +SSN +++H++ DF H T Sbjct: 1784 DPDQL--TSSRTESSNQLDAGKLKHIRAVSDFIYHGT 1818 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 21.0 bits (42), Expect = 9.9 Identities = 10/32 (31%), Positives = 14/32 (43%) Frame = +1 Query: 241 DSSAFDYEPSRRFYRTSRQSTQILSYINIKSA 336 + S DY P+ + ST + Y KSA Sbjct: 117 ECSRIDYFPNEEYSPDPSDSTMAIPYAVTKSA 148 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 21.0 bits (42), Expect = 9.9 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +2 Query: 407 QAPAQIFVDSNVASVHVSAT 466 +APAQI VD V +V +SA+ Sbjct: 174 KAPAQIPVDVLVLTVTLSAS 193 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 173,077 Number of Sequences: 438 Number of extensions: 3701 Number of successful extensions: 19 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18826962 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -