BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060675.seq (634 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g19270.1 68414.m02397 ubiquitin interaction motif-containing ... 42 3e-04 At5g66610.1 68418.m08396 LIM domain-containing protein contains ... 37 0.013 At5g66630.1 68418.m08398 LIM domain-containing protein contains ... 32 0.28 At5g17890.1 68418.m02098 LIM domain-containing protein / disease... 32 0.36 At4g36860.1 68417.m05226 LIM domain-containing protein low simil... 32 0.36 At4g16760.1 68417.m02531 acyl-CoA oxidase (ACX1) identical to ac... 31 0.84 At2g39830.1 68415.m04892 LIM domain-containing protein contains ... 31 0.84 At1g10200.1 68414.m01150 transcription factor LIM, putative stro... 29 1.9 At5g66620.1 68418.m08397 LIM domain-containing protein contains ... 29 2.6 At5g01760.1 68418.m00095 VHS domain-containing protein / GAT dom... 29 2.6 At2g46440.1 68415.m05779 cyclic nucleotide-regulated ion channel... 29 2.6 At2g35690.1 68415.m04377 acyl-CoA oxidase, putative strong simil... 29 2.6 At3g45530.1 68416.m04917 DC1 domain-containing protein contains ... 29 3.4 At2g39900.1 68415.m04904 LIM domain-containing protein similar t... 29 3.4 At1g25250.1 68414.m03133 zinc finger (C2H2 type) family protein ... 29 3.4 At4g39370.2 68417.m05572 ubiquitin-specific protease 27, putativ... 28 4.5 At4g39370.1 68417.m05573 ubiquitin-specific protease 27, putativ... 28 4.5 At5g29624.1 68418.m03640 DC1 domain-containing protein contains ... 28 5.9 At5g22620.1 68418.m02643 phosphoglycerate/bisphosphoglycerate mu... 28 5.9 At2g45800.1 68415.m05696 LIM domain-containing protein similar t... 28 5.9 At3g61230.1 68416.m06852 LIM domain-containing protein similar t... 27 7.8 At2g24800.1 68415.m02967 peroxidase, putative similar to peroxid... 27 7.8 At1g03630.1 68414.m00343 protochlorophyllide reductase C, chloro... 27 7.8 At1g01780.1 68414.m00097 LIM domain-containing protein similar t... 27 7.8 >At1g19270.1 68414.m02397 ubiquitin interaction motif-containing protein / LIM domain-containing protein weak similarity to LIM-homeobox protein [Mus musculus] GI:2149584, Hic-5 [Mus musculus] GI:664955; contains Pfam profiles PF02809: Ubiquitin interaction motif, PF00412: LIM domain Length = 532 Score = 41.9 bits (94), Expect = 3e-04 Identities = 18/47 (38%), Positives = 25/47 (53%) Frame = +2 Query: 275 FQVLFAPCCAKCGEFVIGRVIKAMNSNWHPACFRCEECNVELADAGF 415 FQ+ F C E GR + +NS WHP CFRC C+ +++ F Sbjct: 165 FQMDFRICAGCNMEIGHGRFLNCLNSLWHPECFRCYGCSQPISEYEF 211 Score = 27.9 bits (59), Expect = 5.9 Identities = 15/52 (28%), Positives = 21/52 (40%) Frame = +3 Query: 93 TMSLDNMYCTRCGDGFEPNEKIVNSNGELWHTNCFVCAQCFRMFPDGVFYEF 248 T +D C C + + +N LWH CF C C + + YEF Sbjct: 164 TFQMDFRICAGCNMEIG-HGRFLNCLNSLWHPECFRCYGCSQPISE---YEF 211 >At5g66610.1 68418.m08396 LIM domain-containing protein contains Pfam profile PF00412: LIM domain Length = 529 Score = 36.7 bits (81), Expect = 0.013 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +2 Query: 299 CAKCGEFV-IGRVIKAMNSNWHPACFRCEECNVELADAGFIKH 424 C C + GR + A+ NWHP CF C C+ +A + +H Sbjct: 201 CDGCKSAIEYGRSVHALGVNWHPECFCCRYCDKPIAMHEYKEH 243 >At5g66630.1 68418.m08398 LIM domain-containing protein contains low similarity to Pfam profile PF00412: LIM domain Length = 702 Score = 32.3 bits (70), Expect = 0.28 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +3 Query: 117 CTRCGDGFEPNEKIVNSNGELWHTNCFVCAQC 212 C C + +E+ VN G LWH CF C C Sbjct: 347 CGGCNSAVK-HEESVNILGVLWHPGCFCCRSC 377 Score = 28.3 bits (60), Expect = 4.5 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +2 Query: 356 WHPACFRCEECNVELA 403 WHP CF C C+ +A Sbjct: 367 WHPGCFCCRSCDKPIA 382 >At5g17890.1 68418.m02098 LIM domain-containing protein / disease resistance protein-related low similarity to disease resistance protein RPP4 [Arabidopsis thaliana] GI:20270890; contains Pfam profiles PF00412: LIM domain, PF00931: NB-ARC domain, PF00560: Leucine Rich Repeat Length = 1613 Score = 31.9 bits (69), Expect = 0.36 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = +3 Query: 117 CTRCGDGFEPNEKIVNSNGELWHTNCFVCAQC 212 C C E I N+ G +WH CF C +C Sbjct: 1240 CKDCKSAIEDGISI-NAYGSVWHPQCFCCLRC 1270 Score = 30.3 bits (65), Expect = 1.1 Identities = 14/36 (38%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = +2 Query: 299 CAKCGEFVI-GRVIKAMNSNWHPACFRCEECNVELA 403 C C + G I A S WHP CF C C +A Sbjct: 1240 CKDCKSAIEDGISINAYGSVWHPQCFCCLRCREPIA 1275 >At4g36860.1 68417.m05226 LIM domain-containing protein low similarity to LIM-domain protein [Branchiostoma floridae] GI:3360516, DRAL/Slim3/FHL2 [Homo sapiens] GI:7209525; contains Pfam profile PF00412: LIM domain Length = 351 Score = 31.9 bits (69), Expect = 0.36 Identities = 16/52 (30%), Positives = 21/52 (40%), Gaps = 3/52 (5%) Frame = +2 Query: 344 MNSNWHPACFRCEECNVELADAGFIKHAGR---ALCHVCNARIKADGLQNYM 490 M WHP CF C C+ + D F R LC+ K D N++ Sbjct: 1 MGGVWHPECFCCNACDKPIIDYEFSMSGNRPYHKLCYKEQHHPKCDVCHNFI 52 >At4g16760.1 68417.m02531 acyl-CoA oxidase (ACX1) identical to acyl-CoA oxidase [Arabidopsis thaliana] GI:3044214 Length = 675 Score = 30.7 bits (66), Expect = 0.84 Identities = 21/88 (23%), Positives = 37/88 (42%) Frame = +3 Query: 42 LIKTRFFSLPNASLFLATMSLDNMYCTRCGDGFEPNEKIVNSNGELWHTNCFVCAQCFRM 221 L + F +LP A T L ++ T DG E K+ +G LW C + F + Sbjct: 362 LAASDFATLPEAHA--CTAGLKSLTTTATADGIEECRKLCGGHGYLW---CSGLPELFAV 416 Query: 222 FPDGVFYEFEGESIVNRISKFYLHHAVQ 305 + YE + + ++++F + Q Sbjct: 417 YVPACTYEGDNVVLQLQVARFLMKTVAQ 444 >At2g39830.1 68415.m04892 LIM domain-containing protein contains Pfam profile PF00412: LIM domain Length = 503 Score = 30.7 bits (66), Expect = 0.84 Identities = 11/37 (29%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = +2 Query: 299 CAKCGEFV-IGRVIKAMNSNWHPACFRCEECNVELAD 406 C C + G + M + +HP CFRC C + + Sbjct: 162 CGGCNSDIGSGNYLGCMGTFFHPECFRCHSCGYAITE 198 >At1g10200.1 68414.m01150 transcription factor LIM, putative strong similarity to transcription factor Ntlim1 [Nicotiana tabacum] GI:5689136, LIM domain protein WLIM-1 [Helianthus annuus] GI:5070280; contains Pfam profile PF00412: LIM domain Length = 190 Score = 29.5 bits (63), Expect = 1.9 Identities = 12/49 (24%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Frame = +2 Query: 299 CAKCGEFVIGRVIKAMNSN-WHPACFRCEECNVELADAGFIKHAGRALC 442 C C + V ++N +H +CF+C ++ + +I H G+ C Sbjct: 110 CVGCDKTVYPIEKVSVNGTLYHKSCFKCTHGGCTISPSNYIAHEGKLYC 158 Score = 29.1 bits (62), Expect = 2.6 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +3 Query: 117 CTRCGDGFEPNEKIVNSNGELWHTNCFVC 203 C C P EK V+ NG L+H +CF C Sbjct: 110 CVGCDKTVYPIEK-VSVNGTLYHKSCFKC 137 Score = 28.7 bits (61), Expect = 3.4 Identities = 15/49 (30%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = +2 Query: 299 CAKCGEFV-IGRVIKAMNSNWHPACFRCEECNVELADAGFIKHAGRALC 442 C C + V + + A N +H ACFRC C L + + G C Sbjct: 10 CMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYC 58 >At5g66620.1 68418.m08397 LIM domain-containing protein contains Pfam profile PF00412: LIM domain Length = 644 Score = 29.1 bits (62), Expect = 2.6 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +3 Query: 159 VNSNGELWHTNCFVCAQCFR 218 VN G LWH CF C C + Sbjct: 299 VNILGVLWHPGCFCCRACHK 318 Score = 28.7 bits (61), Expect = 3.4 Identities = 12/36 (33%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = +2 Query: 299 CAKCGEFVI-GRVIKAMNSNWHPACFRCEECNVELA 403 C C V G + + WHP CF C C+ +A Sbjct: 286 CGGCNFAVEHGGSVNILGVLWHPGCFCCRACHKPIA 321 >At5g01760.1 68418.m00095 VHS domain-containing protein / GAT domain-containing protein weak similarity to Hrs [Rattus norvegicus] GI:8547026; contains Pfam profiles PF00790: VHS domain, PF03127: GAT domain Length = 542 Score = 29.1 bits (62), Expect = 2.6 Identities = 20/65 (30%), Positives = 28/65 (43%), Gaps = 6/65 (9%) Frame = -2 Query: 276 KSCSQYFLPQIHRRHHQETCESTGHKQ------NNLYAIILHWSSQFSHLAQIHPHSEYN 115 K+C + I +H E K+ N L ++ W+ FS +A HPH YN Sbjct: 87 KNCGDFVHSHIAEKHLLEDMVKLVRKKGDFEVRNKLLILLDTWNEAFSGVACKHPH--YN 144 Query: 114 TYYQE 100 YQE Sbjct: 145 WAYQE 149 >At2g46440.1 68415.m05779 cyclic nucleotide-regulated ion channel, putative (CNGC11) similar to cyclic nucleotide and calmodulin-regulated ion channel (cngc3) GI:4581201 from [Arabidopsis thaliana] Length = 588 Score = 29.1 bits (62), Expect = 2.6 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = +2 Query: 308 CGEFVIGRVIKAMNSNWHPACFRCEECNVELADAGFIKHAG 430 CG F I+ ++ W AC R +CN+ + D K AG Sbjct: 182 CGAFWYLSSIERKSTCWRAACARTSDCNLTVTDL-LCKRAG 221 >At2g35690.1 68415.m04377 acyl-CoA oxidase, putative strong similarity to acyl-CoA oxidase [Arabidopsis thaliana] GI:3044214 Length = 664 Score = 29.1 bits (62), Expect = 2.6 Identities = 19/78 (24%), Positives = 34/78 (43%) Frame = +3 Query: 57 FFSLPNASLFLATMSLDNMYCTRCGDGFEPNEKIVNSNGELWHTNCFVCAQCFRMFPDGV 236 F +LP A T L +M + DG E K+ +G LW C + F ++ Sbjct: 367 FATLPEAHA--CTAGLKSMTTSATSDGIEECRKLCGGHGYLW---CSGLPELFAVYVPAC 421 Query: 237 FYEFEGESIVNRISKFYL 290 YE + + ++++F + Sbjct: 422 TYEGDNVVLQLQVARFLM 439 >At3g45530.1 68416.m04917 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 692 Score = 28.7 bits (61), Expect = 3.4 Identities = 12/36 (33%), Positives = 22/36 (61%), Gaps = 3/36 (8%) Frame = +3 Query: 195 FVCAQCFRMFPDGVFYEFEG---ESIVNRISKFYLH 293 F+C C++MF +G FY +G + I + I+ ++H Sbjct: 447 FLCRACYQMFCEGFFYSSKGVNFDLICSSITMPFIH 482 >At2g39900.1 68415.m04904 LIM domain-containing protein similar to pollen specific LIM domain protein 1b [Nicotiana tabacum] GI:6467905, PGPS/D1 [Petunia x hybrida] GI:4105772; contains Pfam profile PF00412: LIM domain Length = 200 Score = 28.7 bits (61), Expect = 3.4 Identities = 13/49 (26%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = +2 Query: 299 CAKCGEFVIG-RVIKAMNSNWHPACFRCEECNVELADAGFIKHAGRALC 442 C C + V ++ A ++H ACF+C C L + + G C Sbjct: 10 CRACEKTVYPVELLSADGISYHKACFKCSHCKSRLQLSNYSSMEGVVYC 58 >At1g25250.1 68414.m03133 zinc finger (C2H2 type) family protein contains zinc finger, C2H2 type, domain, PROSITE:PS00028 Length = 362 Score = 28.7 bits (61), Expect = 3.4 Identities = 14/39 (35%), Positives = 21/39 (53%), Gaps = 3/39 (7%) Frame = -2 Query: 309 HFAQ-HGANKTW--KSCSQYFLPQIHRRHHQETCESTGH 202 HF + H +K W + CS+ + Q + H +TC S GH Sbjct: 107 HFRRKHSVHKQWVCERCSKGYAVQSDYKAHLKTCGSRGH 145 >At4g39370.2 68417.m05572 ubiquitin-specific protease 27, putative (UBP27) similar to GI:11993494; ubiquitin specific protease 66 - Gallus gallus,PID:g3800764 Length = 361 Score = 28.3 bits (60), Expect = 4.5 Identities = 15/48 (31%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = +2 Query: 398 LADAGFIKHAGRALCHVCNARIKADGLQNYMCHKC-HG*LTENLYVIG 538 L G+ +G L H + + ++NY C++C HG + L VIG Sbjct: 263 LHHGGYNIMSGCTLEHCLKKFLNTEKVENYFCYRCWHGAALKYLSVIG 310 >At4g39370.1 68417.m05573 ubiquitin-specific protease 27, putative (UBP27) similar to GI:11993494; ubiquitin specific protease 66 - Gallus gallus,PID:g3800764 Length = 494 Score = 28.3 bits (60), Expect = 4.5 Identities = 15/48 (31%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = +2 Query: 398 LADAGFIKHAGRALCHVCNARIKADGLQNYMCHKC-HG*LTENLYVIG 538 L G+ +G L H + + ++NY C++C HG + L VIG Sbjct: 263 LHHGGYNIMSGCTLEHCLKKFLNTEKVENYFCYRCWHGAALKYLSVIG 310 >At5g29624.1 68418.m03640 DC1 domain-containing protein contains Pfam PF03107: DC1 domain Length = 488 Score = 27.9 bits (59), Expect = 5.9 Identities = 29/113 (25%), Positives = 45/113 (39%), Gaps = 13/113 (11%) Frame = +2 Query: 299 CAKCGEFVIGRVIKAMNSNWHPACFRCEECNVELADAGFIKHAGRALCHVCNARIKADGL 478 C +CG + + IK + NW C N+ + CH C +RIK+ Sbjct: 64 CTECGLNMHKKCIKRLFLNWPFLCNHV--LNIFQNTFTSSDNIDDFSCHFCQSRIKSSFA 121 Query: 479 QNYMCH-----KCHG*LTENLYVI---GEKFTMG-----YHFTCATCGVELDH 598 + +C+ KC L L + K+++ F C+ CGVE DH Sbjct: 122 RFTLCNINVDEKCMVELQPPLKISEPKHHKYSLTILLWLVTFICSPCGVEGDH 174 >At5g22620.1 68418.m02643 phosphoglycerate/bisphosphoglycerate mutase family protein weak similarity to SP|P15259 Phosphoglycerate mutase, muscle form (EC 5.4.2.1 {Homo sapiens}; contains Pfam profile PF00300: phosphoglycerate mutase family Length = 482 Score = 27.9 bits (59), Expect = 5.9 Identities = 16/54 (29%), Positives = 23/54 (42%) Frame = -2 Query: 441 HNARPACLIKPASASSTLHSSHRKQAGCQLEFIAFITRPITNSPHFAQHGANKT 280 HNA L+ A T + Q+ C + + FI R SPH + N+T Sbjct: 196 HNAVNQALLATAIGLGTEYFRSLLQSNCGVSVLDFIPRADGGSPHVCLNRLNQT 249 >At2g45800.1 68415.m05696 LIM domain-containing protein similar to PGPS/D1 [Petunia x hybrida] GI:4105772, LIM domain protein PLIM1 [Nicotiana tabacum] GI:5932418; contains Pfam profile PF00412: LIM domain Length = 226 Score = 27.9 bits (59), Expect = 5.9 Identities = 13/49 (26%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +2 Query: 299 CAKCGEFVIGRVIKAMNSN-WHPACFRCEECNVELADAGFIKHAGRALC 442 C C + V + + N +H +CFRC C L + + G C Sbjct: 10 CKACDKTVYVMDLLTLEGNTYHKSCFRCTHCKGTLVISNYSSMDGVLYC 58 >At3g61230.1 68416.m06852 LIM domain-containing protein similar to SP|P29675 Pollen specific protein SF3 {Helianthus annuus}; contains Pfam profile PF00412: LIM domain Length = 213 Score = 27.5 bits (58), Expect = 7.8 Identities = 10/29 (34%), Positives = 13/29 (44%) Frame = +2 Query: 356 WHPACFRCEECNVELADAGFIKHAGRALC 442 +H +CFRC CN L + G C Sbjct: 31 YHKSCFRCSHCNGTLVICNYSSMDGVLYC 59 >At2g24800.1 68415.m02967 peroxidase, putative similar to peroxidase [Spinacia oleracea] gi|1781338|emb|CAA71496 Length = 329 Score = 27.5 bits (58), Expect = 7.8 Identities = 15/50 (30%), Positives = 23/50 (46%), Gaps = 4/50 (8%) Frame = +3 Query: 39 NLIKTRFFSLPNASLFLATMSLDNMYC----TRCGDGFEPNEKIVNSNGE 176 N +RF P +L L SLDN Y +C +P +V+++ E Sbjct: 202 NTFNSRFKLDPKGNLELIDASLDNSYAQTLVNKCSSSLDPTTTVVDNDPE 251 >At1g03630.1 68414.m00343 protochlorophyllide reductase C, chloroplast / PCR C / NADPH-protochlorophyllide oxidoreductase C (PORC) identical to SP:O48741 protochlorophyllide reductase C, chloroplast precursor (EC 1.3.1.33) (PCR C) (NADPH-protochlorophyllide oxidoreductase C) (POR C) [Arabidopsis thaliana] Length = 401 Score = 27.5 bits (58), Expect = 7.8 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = -2 Query: 291 ANKTWKSCSQYFLPQIHRRHHQET 220 A K K C+ + ++HRR+H+ET Sbjct: 275 AYKDSKVCNMLTMQELHRRYHEET 298 >At1g01780.1 68414.m00097 LIM domain-containing protein similar to PGPS/D1 [Petunia x hybrida] GI:4105772, LIM domain protein PLIM1 [Nicotiana tabacum] GI:5932418; contains Pfam profile PF00412: LIM domain Length = 205 Score = 27.5 bits (58), Expect = 7.8 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +3 Query: 117 CTRCGDGFEPNEKIVNSNGELWHTNCFVCA 206 C C P EKI GE +H CF CA Sbjct: 104 CAACEKTVYPLEKI-QMEGECFHKTCFRCA 132 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,917,004 Number of Sequences: 28952 Number of extensions: 334865 Number of successful extensions: 961 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 900 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 961 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1295224128 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -