BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060672.seq (691 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicas... 29 0.036 >AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicase protein. Length = 580 Score = 29.1 bits (62), Expect = 0.036 Identities = 14/28 (50%), Positives = 20/28 (71%), Gaps = 2/28 (7%) Frame = +2 Query: 539 QTGSGKTLAYILPAIVHI--NNQPPISE 616 QTGSGKT A++LP I ++ + PP +E Sbjct: 203 QTGSGKTAAFMLPIIHNLLSDKNPPNTE 230 Score = 28.3 bits (60), Expect = 0.063 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = +1 Query: 403 IQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIV 510 I FE + ++ + VK GY +PT IQ P++ Sbjct: 157 ITSFETSGLRPHLLENVKKSGYTKPTAIQKYAIPVI 192 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 155,707 Number of Sequences: 336 Number of extensions: 3309 Number of successful extensions: 5 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18114270 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -