BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060672.seq (691 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 38 7e-05 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 21 8.4 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 38.3 bits (85), Expect = 7e-05 Identities = 17/43 (39%), Positives = 23/43 (53%) Frame = +1 Query: 382 GVEVHNXIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIV 510 G V I+ FE A + V +K GYK+PTP+Q PI+ Sbjct: 188 GDNVPQPIESFEAAGLRNIVLDNIKKSGYKKPTPVQKHALPII 230 Score = 25.0 bits (52), Expect = 0.68 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = +2 Query: 539 QTGSGKTLAYILPAI 583 QTGSGKT A+ +P I Sbjct: 241 QTGSGKTAAFAVPII 255 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 21.4 bits (43), Expect = 8.4 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +2 Query: 98 TGIIAVETVVPNLEEATNSA 157 T + A V P +EE TN+A Sbjct: 412 TALGAAALVAPGMEEPTNTA 431 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 179,787 Number of Sequences: 438 Number of extensions: 3645 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21073995 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -