BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060672.seq (691 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g55150.1 68414.m06298 DEAD box RNA helicase, putative (RH20) ... 63 1e-10 At5g63120.2 68418.m07924 ethylene-responsive DEAD box RNA helica... 54 7e-08 At5g63120.1 68418.m07925 ethylene-responsive DEAD box RNA helica... 54 7e-08 At1g20920.1 68414.m02619 DEAD box RNA helicase, putative similar... 50 2e-06 At2g47330.1 68415.m05908 DEAD/DEAH box helicase, putative simila... 49 3e-06 At3g09620.1 68416.m01141 DEAD/DEAH box helicase, putative simila... 47 1e-05 At3g01540.3 68416.m00084 DEAD box RNA helicase (DRH1) identical ... 41 9e-04 At3g01540.2 68416.m00083 DEAD box RNA helicase (DRH1) identical ... 41 9e-04 At3g01540.1 68416.m00082 DEAD box RNA helicase (DRH1) identical ... 41 9e-04 At5g51280.1 68418.m06357 DEAD-box protein abstrakt, putative 38 0.006 At2g33730.1 68415.m04134 DEAD box RNA helicase, putative similar... 38 0.008 At3g06480.1 68416.m00750 DEAD box RNA helicase, putative similar... 37 0.011 At4g33370.1 68417.m04744 DEAD-box protein abstrakt, putative RNA... 36 0.033 At5g08610.1 68418.m01024 DEAD box RNA helicase (RH26) strong sim... 34 0.10 At5g62190.1 68418.m07807 DEAD box RNA helicase (PRH75) nearly id... 33 0.18 At5g08620.1 68418.m01025 DEAD box RNA helicase (RH25) identical ... 33 0.24 At4g34910.1 68417.m04950 DEAD/DEAH box helicase, putative (RH16)... 33 0.24 At1g77050.1 68414.m08971 DEAD/DEAH box helicase, putative simila... 33 0.24 At5g63630.1 68418.m07989 DEAD box RNA helicase, putative strong ... 32 0.31 At4g16630.1 68417.m02514 DEAD/DEAH box helicase, putative (RH28)... 32 0.31 At3g09720.1 68416.m01151 DEAD/DEAH box helicase, putative simila... 32 0.31 At1g31970.1 68414.m03931 DEAD/DEAH box helicase, putative simila... 31 0.54 At5g14610.1 68418.m01713 DEAD box RNA helicase, putative similar... 31 0.72 At2g40700.1 68415.m05021 DEAD/DEAH box helicase, putative (RH17)... 31 0.72 At3g49500.1 68416.m05410 RNA-dependent RNA polymerase (SDE1) ide... 30 1.3 At1g47330.1 68414.m05240 expressed protein contains Pfam profile... 30 1.3 At1g12770.1 68414.m01482 DEAD/DEAH box helicase family protein /... 30 1.3 At5g64420.1 68418.m08092 DNA polymerase V family contains Pfam d... 30 1.7 At3g06980.1 68416.m00829 DEAD/DEAH box helicase, putative contai... 29 2.2 At4g09730.1 68417.m01598 DEAD/DEAH box helicase, putative RNA he... 29 2.9 At3g58510.2 68416.m06522 DEAD box RNA helicase, putative (RH11) ... 29 2.9 At3g58510.1 68416.m06521 DEAD box RNA helicase, putative (RH11) ... 29 2.9 At3g18600.1 68416.m02364 DEAD/DEAH box helicase, putative non-co... 29 2.9 At5g65900.1 68418.m08295 DEAD/DEAH box helicase, putative contai... 29 3.8 At3g22330.1 68416.m02820 DEAD box RNA helicase, putative similar... 29 3.8 At3g22310.1 68416.m02818 DEAD box RNA helicase, putative (RH9) s... 29 3.8 At1g71370.1 68414.m08239 DEAD/DEAH box helicase, putative simila... 29 3.8 At1g71280.1 68414.m08226 DEAD/DEAH box helicase, putative contai... 29 3.8 At2g33420.1 68415.m04096 expressed protein 28 5.1 At4g15850.1 68417.m02410 DEAD/DEAH box helicase, putative simila... 28 6.7 At1g04470.1 68414.m00438 expressed protein EST gb|ATTS5672 comes... 28 6.7 At5g54910.1 68418.m06839 DEAD/DEAH box helicase, putative 27 8.9 At5g05450.1 68418.m00587 DEAD/DEAH box helicase, putative (RH18) 27 8.9 At3g16090.1 68416.m02033 zinc finger (C3HC4-type RING finger) fa... 27 8.9 At3g02065.2 68416.m00170 DEAD/DEAH box helicase family protein c... 27 8.9 At2g25460.1 68415.m03049 expressed protein 27 8.9 At1g51380.1 68414.m05780 eukaryotic translation initiation facto... 27 8.9 >At1g55150.1 68414.m06298 DEAD box RNA helicase, putative (RH20) similar to ethylene-responsive RNA helicase GI:5669638 from [Lycopersicon esculentum]; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 501 Score = 63.3 bits (147), Expect = 1e-10 Identities = 44/137 (32%), Positives = 55/137 (40%) Frame = +3 Query: 264 DSVSLQPFNKNFYDPHPTVLKRSPYEVEEYRNNHEVTVSGR*GS*SYSIL*RSKFS*LCA 443 D L PF KNFY P V + EVEEYR E+TV G+ F Sbjct: 52 DLDGLTPFEKNFYVESPAVAAMTDTEVEEYRKLREITVEGKDIPKPVKSFRDVGFPDYVL 111 Query: 444 TRCKDNGLQRTDAYSSSRLADSMSGKNLVGVLKRVPAKRWPTSCQPLCT*TTNRLFRRGD 623 K G S +M G++L+G+ + K + + GD Sbjct: 112 EEVKKAGFTEPTPIQSQGWPMAMKGRDLIGIAETGSGKTLSYLLPAIVHVNAQPMLAHGD 171 Query: 624 GPIALVLGATRELAQQI 674 GPI LVL TRELA QI Sbjct: 172 GPIVLVLAPTRELAVQI 188 Score = 53.6 bits (123), Expect = 1e-07 Identities = 20/42 (47%), Positives = 29/42 (69%) Frame = +1 Query: 382 GVEVHNXIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPI 507 G ++ ++ F + FPDYV + VK G+ EPTPIQ+QGWP+ Sbjct: 91 GKDIPKPVKSFRDVGFPDYVLEEVKKAGFTEPTPIQSQGWPM 132 Score = 43.6 bits (98), Expect = 1e-04 Identities = 17/25 (68%), Positives = 23/25 (92%) Frame = +2 Query: 539 QTGSGKTLAYILPAIVHINNQPPIS 613 +TGSGKTL+Y+LPAIVH+N QP ++ Sbjct: 144 ETGSGKTLSYLLPAIVHVNAQPMLA 168 >At5g63120.2 68418.m07924 ethylene-responsive DEAD box RNA helicase, putative (RH30) strong similarity to ethylene-responsive RNA helicase [Lycopersicon esculentum] GI:5669638; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 591 Score = 54.4 bits (125), Expect = 7e-08 Identities = 20/42 (47%), Positives = 31/42 (73%) Frame = +1 Query: 382 GVEVHNXIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPI 507 G +V ++ F++ANFPD + + + +G+ EPTPIQAQGWP+ Sbjct: 157 GRDVPKPMKMFQDANFPDNILEAIAKLGFTEPTPIQAQGWPM 198 Score = 48.0 bits (109), Expect = 6e-06 Identities = 35/134 (26%), Positives = 54/134 (40%) Frame = +3 Query: 273 SLQPFNKNFYDPHPTVLKRSPYEVEEYRNNHEVTVSGR*GS*SYSIL*RSKFS*LCATRC 452 +L F KNFY PTV + +V YR +++V GR + + F Sbjct: 121 NLVHFEKNFYVESPTVQAMTEQDVAMYRTERDISVEGRDVPKPMKMFQDANFPDNILEAI 180 Query: 453 KDNGLQRTDAYSSSRLADSMSGKNLVGVLKRVPAKRWPTSCQPLCT*TTNRLFRRGDGPI 632 G + ++ G++L+G+ + K L + + DGPI Sbjct: 181 AKLGFTEPTPIQAQGWPMALKGRDLIGIAETGSGKTLAYLLPALVHVSAQPRLGQDDGPI 240 Query: 633 ALVLGATRELAQQI 674 L+L TRELA QI Sbjct: 241 VLILAPTRELAVQI 254 Score = 42.3 bits (95), Expect = 3e-04 Identities = 16/26 (61%), Positives = 23/26 (88%) Frame = +2 Query: 539 QTGSGKTLAYILPAIVHINNQPPISE 616 +TGSGKTLAY+LPA+VH++ QP + + Sbjct: 210 ETGSGKTLAYLLPALVHVSAQPRLGQ 235 >At5g63120.1 68418.m07925 ethylene-responsive DEAD box RNA helicase, putative (RH30) strong similarity to ethylene-responsive RNA helicase [Lycopersicon esculentum] GI:5669638; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 484 Score = 54.4 bits (125), Expect = 7e-08 Identities = 20/42 (47%), Positives = 31/42 (73%) Frame = +1 Query: 382 GVEVHNXIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPI 507 G +V ++ F++ANFPD + + + +G+ EPTPIQAQGWP+ Sbjct: 157 GRDVPKPMKMFQDANFPDNILEAIAKLGFTEPTPIQAQGWPM 198 Score = 48.0 bits (109), Expect = 6e-06 Identities = 35/134 (26%), Positives = 54/134 (40%) Frame = +3 Query: 273 SLQPFNKNFYDPHPTVLKRSPYEVEEYRNNHEVTVSGR*GS*SYSIL*RSKFS*LCATRC 452 +L F KNFY PTV + +V YR +++V GR + + F Sbjct: 121 NLVHFEKNFYVESPTVQAMTEQDVAMYRTERDISVEGRDVPKPMKMFQDANFPDNILEAI 180 Query: 453 KDNGLQRTDAYSSSRLADSMSGKNLVGVLKRVPAKRWPTSCQPLCT*TTNRLFRRGDGPI 632 G + ++ G++L+G+ + K L + + DGPI Sbjct: 181 AKLGFTEPTPIQAQGWPMALKGRDLIGIAETGSGKTLAYLLPALVHVSAQPRLGQDDGPI 240 Query: 633 ALVLGATRELAQQI 674 L+L TRELA QI Sbjct: 241 VLILAPTRELAVQI 254 Score = 42.3 bits (95), Expect = 3e-04 Identities = 16/26 (61%), Positives = 23/26 (88%) Frame = +2 Query: 539 QTGSGKTLAYILPAIVHINNQPPISE 616 +TGSGKTLAY+LPA+VH++ QP + + Sbjct: 210 ETGSGKTLAYLLPALVHVSAQPRLGQ 235 >At1g20920.1 68414.m02619 DEAD box RNA helicase, putative similar to RNA helicase [Rattus norvegicus] GI:897915; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 1166 Score = 49.6 bits (113), Expect = 2e-06 Identities = 38/139 (27%), Positives = 55/139 (39%) Frame = +3 Query: 258 DWDSVSLQPFNKNFYDPHPTVLKRSPYEVEEYRNNHEVTVSGR*GS*SYSIL*RSKFS*L 437 D + +PF KNFY + + + EV YR E+ V G+ ++ + Sbjct: 480 DHSKIEYEPFRKNFYIEVKDISRMTQEEVNTYRKELELKVHGKDVPRPIKFWHQTGLTSK 539 Query: 438 CATRCKDNGLQRTDAYSSSRLADSMSGKNLVGVLKRVPAKRWPTSCQPLCT*TTNRLFRR 617 K ++ + L MSG++ +GV K K L Sbjct: 540 ILDTMKKLNYEKPMPIQTQALPIIMSGRDCIGVAKTGSGKTLGFVLPMLRHIKDQPPVEA 599 Query: 618 GDGPIALVLGATRELAQQI 674 GDGPI LV+ TREL QQI Sbjct: 600 GDGPIGLVMAPTRELVQQI 618 Score = 38.7 bits (86), Expect = 0.004 Identities = 14/24 (58%), Positives = 20/24 (83%) Frame = +2 Query: 539 QTGSGKTLAYILPAIVHINNQPPI 610 +TGSGKTL ++LP + HI +QPP+ Sbjct: 574 KTGSGKTLGFVLPMLRHIKDQPPV 597 >At2g47330.1 68415.m05908 DEAD/DEAH box helicase, putative similar to RNA helicase [Rattus norvegicus] GI:897915; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 760 Score = 48.8 bits (111), Expect = 3e-06 Identities = 34/139 (24%), Positives = 57/139 (41%) Frame = +3 Query: 258 DWDSVSLQPFNKNFYDPHPTVLKRSPYEVEEYRNNHEVTVSGR*GS*SYSIL*RSKFS*L 437 D S+ +P NK+FY+ ++ + E +YR + VSG FS Sbjct: 179 DHSSIDYEPINKDFYEELESISGMTEQETTDYRQRLGIRVSGFDVHRPVKTFEDCGFSSQ 238 Query: 438 CATRCKDNGLQRTDAYSSSRLADSMSGKNLVGVLKRVPAKRWPTSCQPLCT*TTNRLFRR 617 + K ++ A L +SG++++G+ K K + +R Sbjct: 239 IMSAIKKQAYEKPTAIQCQALPIVLSGRDVIGIAKTGSGKTAAFVLPMIVHIMDQPELQR 298 Query: 618 GDGPIALVLGATRELAQQI 674 +GPI ++ TRELA QI Sbjct: 299 DEGPIGVICAPTRELAHQI 317 Score = 41.9 bits (94), Expect = 4e-04 Identities = 16/43 (37%), Positives = 24/43 (55%) Frame = +1 Query: 382 GVEVHNXIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIV 510 G +VH ++ FE+ F + +K Y++PT IQ Q PIV Sbjct: 220 GFDVHRPVKTFEDCGFSSQIMSAIKKQAYEKPTAIQCQALPIV 262 Score = 37.5 bits (83), Expect = 0.008 Identities = 15/24 (62%), Positives = 20/24 (83%) Frame = +2 Query: 539 QTGSGKTLAYILPAIVHINNQPPI 610 +TGSGKT A++LP IVHI +QP + Sbjct: 273 KTGSGKTAAFVLPMIVHIMDQPEL 296 >At3g09620.1 68416.m01141 DEAD/DEAH box helicase, putative similar to RNA helicase GB:A57514 GI:897915 from [Rattus norvegicus]; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 989 Score = 46.8 bits (106), Expect = 1e-05 Identities = 37/139 (26%), Positives = 54/139 (38%) Frame = +3 Query: 258 DWDSVSLQPFNKNFYDPHPTVLKRSPYEVEEYRNNHEVTVSGR*GS*SYSIL*RSKFS*L 437 D + +PF KNFY + + + V YR E+ V G+ ++ + Sbjct: 347 DHSKIEYEPFRKNFYIEVKDISRMTQDAVNAYRKELELKVHGKDVPRPIQFWHQTGLTSK 406 Query: 438 CATRCKDNGLQRTDAYSSSRLADSMSGKNLVGVLKRVPAKRWPTSCQPLCT*TTNRLFRR 617 K ++ + L MSG++ +GV K K L Sbjct: 407 ILDTLKKLNYEKPMPIQAQALPIIMSGRDCIGVAKTGSGKTLGFVLPMLRHIKDQPPVEA 466 Query: 618 GDGPIALVLGATRELAQQI 674 GDGPI LV+ TREL QQI Sbjct: 467 GDGPIGLVMAPTRELVQQI 485 Score = 38.7 bits (86), Expect = 0.004 Identities = 14/24 (58%), Positives = 20/24 (83%) Frame = +2 Query: 539 QTGSGKTLAYILPAIVHINNQPPI 610 +TGSGKTL ++LP + HI +QPP+ Sbjct: 441 KTGSGKTLGFVLPMLRHIKDQPPV 464 Score = 35.1 bits (77), Expect = 0.044 Identities = 14/43 (32%), Positives = 24/43 (55%) Frame = +1 Query: 382 GVEVHNXIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIV 510 G +V IQ++ + + +K + Y++P PIQAQ PI+ Sbjct: 388 GKDVPRPIQFWHQTGLTSKILDTLKKLNYEKPMPIQAQALPII 430 >At3g01540.3 68416.m00084 DEAD box RNA helicase (DRH1) identical to RNA helicase DRH1 GB:BAA28347 GI:3149952 [Arabidopsis thaliana]; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 619 Score = 40.7 bits (91), Expect = 9e-04 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = +1 Query: 382 GVEVHNXIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPI 507 G +V + FE FP + + V + G+ PTPIQAQ WPI Sbjct: 150 GGQVPPPLMSFEATGFPPELLREVLSAGFSAPTPIQAQSWPI 191 Score = 30.3 bits (65), Expect = 1.3 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = +2 Query: 539 QTGSGKTLAYILPAIVHI 592 +TGSGKTL Y++P +H+ Sbjct: 203 KTGSGKTLGYLIPGFLHL 220 >At3g01540.2 68416.m00083 DEAD box RNA helicase (DRH1) identical to RNA helicase DRH1 GB:BAA28347 GI:3149952 [Arabidopsis thaliana]; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 619 Score = 40.7 bits (91), Expect = 9e-04 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = +1 Query: 382 GVEVHNXIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPI 507 G +V + FE FP + + V + G+ PTPIQAQ WPI Sbjct: 150 GGQVPPPLMSFEATGFPPELLREVLSAGFSAPTPIQAQSWPI 191 Score = 30.3 bits (65), Expect = 1.3 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = +2 Query: 539 QTGSGKTLAYILPAIVHI 592 +TGSGKTL Y++P +H+ Sbjct: 203 KTGSGKTLGYLIPGFLHL 220 >At3g01540.1 68416.m00082 DEAD box RNA helicase (DRH1) identical to RNA helicase DRH1 GB:BAA28347 GI:3149952 [Arabidopsis thaliana]; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 618 Score = 40.7 bits (91), Expect = 9e-04 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = +1 Query: 382 GVEVHNXIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPI 507 G +V + FE FP + + V + G+ PTPIQAQ WPI Sbjct: 150 GGQVPPPLMSFEATGFPPELLREVLSAGFSAPTPIQAQSWPI 191 Score = 30.3 bits (65), Expect = 1.3 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = +2 Query: 539 QTGSGKTLAYILPAIVHI 592 +TGSGKTL Y++P +H+ Sbjct: 203 KTGSGKTLGYLIPGFLHL 220 >At5g51280.1 68418.m06357 DEAD-box protein abstrakt, putative Length = 591 Score = 37.9 bits (84), Expect = 0.006 Identities = 24/74 (32%), Positives = 36/74 (48%), Gaps = 1/74 (1%) Frame = +1 Query: 304 IHILQFS-KDHHMKSKSTEIITR*L*VGVEVHNXIQYFEEANFPDYVQQGVKTMGYKEPT 480 +HI + S K + K II G ++ I+ F++ FP V +K G +PT Sbjct: 115 LHIRKMSSKQRDLIRKQWHIIVN----GDDIPPPIKNFKDMKFPRPVLDTLKEKGIVQPT 170 Query: 481 PIQAQGWPIVCLER 522 PIQ QG P++ R Sbjct: 171 PIQVQGLPVILAGR 184 >At2g33730.1 68415.m04134 DEAD box RNA helicase, putative similar to SP|P23394 Pre-mRNA splicing factor RNA helicase PRP28 {Saccharomyces cerevisiae}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 733 Score = 37.5 bits (83), Expect = 0.008 Identities = 14/26 (53%), Positives = 21/26 (80%) Frame = +2 Query: 539 QTGSGKTLAYILPAIVHINNQPPISE 616 +TGSGKT A++LP + +I+ PP+SE Sbjct: 358 ETGSGKTAAFVLPMLAYISRLPPMSE 383 Score = 29.9 bits (64), Expect = 1.7 Identities = 13/47 (27%), Positives = 25/47 (53%) Frame = +1 Query: 382 GVEVHNXIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIVCLER 522 G + ++ +EE+ + + V+ GYK+P+PIQ P+ +R Sbjct: 305 GSRIPRPMRSWEESKLTSELLKAVERAGYKKPSPIQMAAIPLGLQQR 351 Score = 28.7 bits (61), Expect = 3.8 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +3 Query: 621 DGPIALVLGATRELAQQI 674 +GP A+V+ TRELAQQI Sbjct: 388 EGPYAVVMAPTRELAQQI 405 >At3g06480.1 68416.m00750 DEAD box RNA helicase, putative similar to RNA helicase DRH1 [Arabidopsis thaliana] GI:3149952; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain, PF00397: WW domain Length = 1088 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +1 Query: 412 FEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIVCLER 522 FE + P + + + + G+ PTPIQAQ WPI R Sbjct: 437 FESSGLPPEILRELLSAGFPSPTPIQAQTWPIALQSR 473 Score = 28.7 bits (61), Expect = 3.8 Identities = 10/16 (62%), Positives = 14/16 (87%) Frame = +2 Query: 539 QTGSGKTLAYILPAIV 586 +TGSGKTL Y++PA + Sbjct: 480 KTGSGKTLGYLIPAFI 495 >At4g33370.1 68417.m04744 DEAD-box protein abstrakt, putative RNA helicase DBP2 - Saccharomyces cerevisiae, PID:g5272 Length = 542 Score = 35.5 bits (78), Expect = 0.033 Identities = 16/43 (37%), Positives = 24/43 (55%) Frame = +1 Query: 382 GVEVHNXIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIV 510 G ++ I+ F + FP + + +K G PTPIQ QG P+V Sbjct: 89 GEDIPPPIKNFMDMKFPSPLLRMLKDKGIMHPTPIQVQGLPVV 131 Score = 30.3 bits (65), Expect = 1.3 Identities = 30/128 (23%), Positives = 50/128 (39%), Gaps = 3/128 (2%) Frame = +3 Query: 297 FYDPHPTVLKRSPYEVEEYRNNHEVTVSGR*GS*SYSIL*RSKFS*LCATRCKDNGLQRT 476 ++ P V K S +++ R +TV+G KF KD G+ Sbjct: 61 WWKPPLHVRKMSTKQMDLIRKQWHITVNGEDIPPPIKNFMDMKFPSPLLRMLKDKGIMHP 120 Query: 477 DAYSSSRLADSMSGKNLVGVLKRVPAKRWPTSCQPLCT*TTNRLFR---RGDGPIALVLG 647 L +SG++++G+ K + + G+GPIALV+ Sbjct: 121 TPIQVQGLPVVLSGRDMIGIAFTGSGKTLVFVLPMIILALQEEIMMPIAAGEGPIALVIC 180 Query: 648 ATRELAQQ 671 +RELA+Q Sbjct: 181 PSRELAKQ 188 Score = 27.5 bits (58), Expect = 8.9 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = +2 Query: 542 TGSGKTLAYILPAIV 586 TGSGKTL ++LP I+ Sbjct: 143 TGSGKTLVFVLPMII 157 >At5g08610.1 68418.m01024 DEAD box RNA helicase (RH26) strong similarity to RNA helicase RH26 [Arabidopsis thaliana] GI:3776025; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain; identical to cDNA DEAD box RNA helicase, RH26 GI:3776024 Length = 850 Score = 33.9 bits (74), Expect = 0.10 Identities = 14/32 (43%), Positives = 22/32 (68%) Frame = +2 Query: 518 KEFSWRTQTGSGKTLAYILPAIVHINNQPPIS 613 K+ + +TG+GKT+A++LPAI + PP S Sbjct: 420 KDVLAKAKTGTGKTVAFLLPAIEAVIKSPPAS 451 >At5g62190.1 68418.m07807 DEAD box RNA helicase (PRH75) nearly identical to RNA helicase [Arabidopsis thaliana] GI:1488521; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 671 Score = 33.1 bits (72), Expect = 0.18 Identities = 14/29 (48%), Positives = 20/29 (68%) Frame = +2 Query: 533 RTQTGSGKTLAYILPAIVHINNQPPISER 619 R +TG GKTLA++LP + + N P S+R Sbjct: 139 RARTGQGKTLAFVLPILESLVNGPAKSKR 167 >At5g08620.1 68418.m01025 DEAD box RNA helicase (RH25) identical to RNA helicase [Arabidopsis thaliana] GI:3776023; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 563 Score = 32.7 bits (71), Expect = 0.24 Identities = 13/32 (40%), Positives = 22/32 (68%) Frame = +2 Query: 518 KEFSWRTQTGSGKTLAYILPAIVHINNQPPIS 613 K+ + +TG+GKT+A++LP+I + PP S Sbjct: 118 KDILAKAKTGTGKTVAFLLPSIEAVIKAPPAS 149 >At4g34910.1 68417.m04950 DEAD/DEAH box helicase, putative (RH16) identical to cDNA DEAD box RNA helicase, RH16 GI:3776006 Length = 626 Score = 32.7 bits (71), Expect = 0.24 Identities = 14/34 (41%), Positives = 23/34 (67%) Frame = +2 Query: 518 KEFSWRTQTGSGKTLAYILPAIVHINNQPPISER 619 K+ R +TGSGKTLAY+LP + + + +S++ Sbjct: 84 KDVVARAKTGSGKTLAYLLPLLQKLFSADSVSKK 117 >At1g77050.1 68414.m08971 DEAD/DEAH box helicase, putative similar to RNA helicase GI:3776027 from [Arabidopsis thaliana] Length = 513 Score = 32.7 bits (71), Expect = 0.24 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 412 FEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIV 510 FE N V +K GYK PTPIQ + P++ Sbjct: 30 FESLNLGPNVFNAIKKKGYKVPTPIQRKTMPLI 62 >At5g63630.1 68418.m07989 DEAD box RNA helicase, putative strong similarity to RNA helicase RH25 [Arabidopsis thaliana] GI:3776023; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain; identical to cDNA DEAD box RNA helicase, RH31 GI:3776030 Length = 522 Score = 32.3 bits (70), Expect = 0.31 Identities = 13/32 (40%), Positives = 22/32 (68%) Frame = +2 Query: 518 KEFSWRTQTGSGKTLAYILPAIVHINNQPPIS 613 K+ + +TG+GKT+A++LP+I + PP S Sbjct: 92 KDVLAKAKTGTGKTVAFLLPSIEVVVKSPPTS 123 >At4g16630.1 68417.m02514 DEAD/DEAH box helicase, putative (RH28) identical to cDNA DEAD box RNA helicase, RH28 GI:3776026 Length = 789 Score = 32.3 bits (70), Expect = 0.31 Identities = 18/47 (38%), Positives = 24/47 (51%) Frame = +1 Query: 382 GVEVHNXIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIVCLER 522 GV H F E N + + +T+GYK+PTPIQA P+ R Sbjct: 161 GVSFH--ADTFMELNLSRPLLRACETLGYKKPTPIQAACIPLALTGR 205 >At3g09720.1 68416.m01151 DEAD/DEAH box helicase, putative similar to RNA helicase involved in rRNA processing GB:6321267 from [Saccharomyces cerevisiae]c, ontains DEAD and DEAH box domain Length = 541 Score = 32.3 bits (70), Expect = 0.31 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = +1 Query: 436 YVQQGVKTMGYKEPTPIQAQGWPIV 510 Y+ + + +G+KEPTPIQ Q PI+ Sbjct: 151 YILRNLAELGFKEPTPIQRQAIPIL 175 >At1g31970.1 68414.m03931 DEAD/DEAH box helicase, putative similar to p68 RNA helicase [Schizosaccharomyces pombe] GI:173419 Length = 537 Score = 31.5 bits (68), Expect = 0.54 Identities = 12/18 (66%), Positives = 17/18 (94%) Frame = +2 Query: 539 QTGSGKTLAYILPAIVHI 592 +TGSGKTLA+ +PAI+H+ Sbjct: 159 KTGSGKTLAFGIPAIMHV 176 Score = 31.1 bits (67), Expect = 0.72 Identities = 13/36 (36%), Positives = 23/36 (63%) Frame = +1 Query: 403 IQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIV 510 ++ F E+N P+ V KT +++P+PIQ+ WP + Sbjct: 115 LKTFAESNLPENVLDCCKT--FEKPSPIQSHTWPFL 148 >At5g14610.1 68418.m01713 DEAD box RNA helicase, putative similar to RNA helicase DRH1 [Arabidopsis thaliana] GI:3149952; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain, PF00397: WW domain Length = 713 Score = 31.1 bits (67), Expect = 0.72 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +1 Query: 451 VKTMGYKEPTPIQAQGWPIVCLER 522 V + G+ P+PIQAQ WPI R Sbjct: 244 VYSAGFSAPSPIQAQSWPIAMQNR 267 Score = 30.3 bits (65), Expect = 1.3 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = +2 Query: 539 QTGSGKTLAYILPAIVHI 592 +TGSGKTL Y++P +H+ Sbjct: 274 KTGSGKTLGYLIPGFMHL 291 >At2g40700.1 68415.m05021 DEAD/DEAH box helicase, putative (RH17) identical to GB:CAA09207, contains a DEAD/DEAH box family ATP-dependent helicas signature; identical to cDNA DEAD box RNA helicase, RH17 GI:3776008 Length = 609 Score = 31.1 bits (67), Expect = 0.72 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 Query: 542 TGSGKTLAYILPAIVHINNQPPISER 619 TG+GKT+AY+ P I H+ P +R Sbjct: 76 TGTGKTIAYLAPLIHHLQGHSPKVDR 101 >At3g49500.1 68416.m05410 RNA-dependent RNA polymerase (SDE1) identical to RNA-dependent RNA polymerase [Arabidopsis thaliana] gi|8248473|gb|AAF74208 Length = 1196 Score = 30.3 bits (65), Expect = 1.3 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +2 Query: 194 LEDLEDLVGKKNSLEVRTCVARLGFCFTPTF 286 + D++ +GK V C AR+G CF+ T+ Sbjct: 530 VSDIKTWMGKFKDKNVAKCAARMGLCFSSTY 560 >At1g47330.1 68414.m05240 expressed protein contains Pfam profile PF01595: Domain of unknown function Length = 527 Score = 30.3 bits (65), Expect = 1.3 Identities = 17/55 (30%), Positives = 25/55 (45%) Frame = +2 Query: 416 KKQIFLIMCNKV*RQWVTKNRRLFKLKAGR*YVWKEFSWRTQTGSGKTLAYILPA 580 K ++F C K Q+ + +FK++ G K + Q GSGKT PA Sbjct: 332 KDELFKDSCRKPKAQFEVSEKEVFKIETGDAKSGKSENGEEQQGSGKTSLLAAPA 386 >At1g12770.1 68414.m01482 DEAD/DEAH box helicase family protein / pentatricopeptide (PPR) repeat-containing protein contains Pfam profiles: PF00271 helicase conserved C-terminal domain, PF01535 PPR repeat, PF00270: DEAD/DEAH box helicase Length = 1145 Score = 30.3 bits (65), Expect = 1.3 Identities = 14/29 (48%), Positives = 21/29 (72%) Frame = +2 Query: 533 RTQTGSGKTLAYILPAIVHINNQPPISER 619 ++ TGSGKTLAY+LP + I P++E+ Sbjct: 153 QSYTGSGKTLAYLLPILSEIG---PLAEK 178 >At5g64420.1 68418.m08092 DNA polymerase V family contains Pfam domain PF04931: DNA polymerase V Length = 1306 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/38 (31%), Positives = 23/38 (60%) Frame = -1 Query: 295 FLLKGWSETESQSGDACSDLQRILFSHQILQILQIYCH 182 +L + + E +Q+G + Q +LF ++L +L+IY H Sbjct: 982 YLAQIFKEKRNQAGGETAQSQLVLFKLRVLSLLEIYLH 1019 >At3g06980.1 68416.m00829 DEAD/DEAH box helicase, putative contains Pfam profile: PF00270 DEAD/DEAH box helicase Length = 781 Score = 29.5 bits (63), Expect = 2.2 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = +2 Query: 539 QTGSGKTLAYILPAIVHINNQ 601 Q+GSGKTLAY++P I + + Sbjct: 419 QSGSGKTLAYLVPVIQRLREE 439 >At4g09730.1 68417.m01598 DEAD/DEAH box helicase, putative RNA helicase -Mus musculus,PIR2:I84741 Length = 621 Score = 29.1 bits (62), Expect = 2.9 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 536 TQTGSGKTLAYILPAI 583 + TGSGKTLAY+LP + Sbjct: 156 SHTGSGKTLAYLLPIV 171 >At3g58510.2 68416.m06522 DEAD box RNA helicase, putative (RH11) similar to RNA helicase DBY protein [Mus musculus] GI:3790186, SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain; identical to cDNA DEAD box RNA helicase, RH11 GI:3775998 Length = 612 Score = 29.1 bits (62), Expect = 2.9 Identities = 13/47 (27%), Positives = 22/47 (46%) Frame = +1 Query: 382 GVEVHNXIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIVCLER 522 G +V + F + + D + ++ Y PTP+Q PI+ ER Sbjct: 143 GGDVPPPVNTFADIDLGDALNLNIRRCKYVRPTPVQRHAIPILLAER 189 >At3g58510.1 68416.m06521 DEAD box RNA helicase, putative (RH11) similar to RNA helicase DBY protein [Mus musculus] GI:3790186, SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain; identical to cDNA DEAD box RNA helicase, RH11 GI:3775998 Length = 612 Score = 29.1 bits (62), Expect = 2.9 Identities = 13/47 (27%), Positives = 22/47 (46%) Frame = +1 Query: 382 GVEVHNXIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIVCLER 522 G +V + F + + D + ++ Y PTP+Q PI+ ER Sbjct: 143 GGDVPPPVNTFADIDLGDALNLNIRRCKYVRPTPVQRHAIPILLAER 189 >At3g18600.1 68416.m02364 DEAD/DEAH box helicase, putative non-consensus acceptor splice site AT at exon 2; similar to DEAD box helicase protein GB:NP_006764 from [Homo sapiens], contains Pfam profile: PF00270 DEAD/DEAH box helicase Length = 568 Score = 29.1 bits (62), Expect = 2.9 Identities = 11/22 (50%), Positives = 17/22 (77%) Frame = +2 Query: 518 KEFSWRTQTGSGKTLAYILPAI 583 K+ +TGSGKTLA+++PA+ Sbjct: 127 KDVLGAARTGSGKTLAFLIPAV 148 >At5g65900.1 68418.m08295 DEAD/DEAH box helicase, putative contains Pfam profiles PF00270:DEAD/DEAH box helicase and PF00271: Helicase conserved C-terminal domain; identical to cDNA RH27 helicase, partial GI:4033334 Length = 633 Score = 28.7 bits (61), Expect = 3.8 Identities = 10/15 (66%), Positives = 15/15 (100%) Frame = +2 Query: 539 QTGSGKTLAYILPAI 583 +TGSGKTLA+++PA+ Sbjct: 199 RTGSGKTLAFLIPAV 213 >At3g22330.1 68416.m02820 DEAD box RNA helicase, putative similar to RNA helicases GI:3775995, GI:3775987 from [Arabidopsis thaliana]; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 616 Score = 28.7 bits (61), Expect = 3.8 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = +3 Query: 615 RGDGPIALVLGATRELAQQI 674 RG P+ LVL TRELA+Q+ Sbjct: 175 RGRNPLCLVLAPTRELARQV 194 >At3g22310.1 68416.m02818 DEAD box RNA helicase, putative (RH9) similar to RNA helicases GI:3775995, GI:3775987 [Arabidopsis thaliana]; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 610 Score = 28.7 bits (61), Expect = 3.8 Identities = 20/75 (26%), Positives = 33/75 (44%), Gaps = 1/75 (1%) Frame = +3 Query: 453 KDNGLQRTDAYSSSRLADSMSGKNLVGVLKRVPAKRWPTSCQPLCT*TT-NRLFRRGDGP 629 K G+++ + L +M G++++G + K + N RG P Sbjct: 132 KGRGIEKLFPIQKAVLEPAMEGRDMIGRARTGTGKTLAFGIPIIDKIIKFNAKHGRGKNP 191 Query: 630 IALVLGATRELAQQI 674 LVL TRELA+Q+ Sbjct: 192 QCLVLAPTRELARQV 206 >At1g71370.1 68414.m08239 DEAD/DEAH box helicase, putative similar to ATP-dependent RNA helicase GB:6321111 from (S. cerevisiae) Length = 558 Score = 28.7 bits (61), Expect = 3.8 Identities = 15/25 (60%), Positives = 18/25 (72%), Gaps = 3/25 (12%) Frame = +2 Query: 542 TGSGKTLAYILPAIVHI---NNQPP 607 TGSGKTLA++LP I I N+ PP Sbjct: 62 TGSGKTLAFLLPFIEIIRRSNSYPP 86 >At1g71280.1 68414.m08226 DEAD/DEAH box helicase, putative contains Pfam profile: PF00270 DEAD/DEAH box helicase Length = 465 Score = 28.7 bits (61), Expect = 3.8 Identities = 15/25 (60%), Positives = 18/25 (72%), Gaps = 3/25 (12%) Frame = +2 Query: 542 TGSGKTLAYILPAIVHI---NNQPP 607 TGSGKTLA++LP I I N+ PP Sbjct: 63 TGSGKTLAFLLPFIEIIRRSNSYPP 87 >At2g33420.1 68415.m04096 expressed protein Length = 1039 Score = 28.3 bits (60), Expect = 5.1 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = +3 Query: 33 SKRIHSLNKHLQLNPKI 83 S IHSLNK L LNP+I Sbjct: 789 SSHIHSLNKTLSLNPRI 805 >At4g15850.1 68417.m02410 DEAD/DEAH box helicase, putative similar to D-E-A-D box protein [Drosophila melanogaster] GI:499204; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 512 Score = 27.9 bits (59), Expect = 6.7 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = +2 Query: 542 TGSGKTLAYILPAIVHINNQP 604 TGSGKTL+Y LP + + ++P Sbjct: 71 TGSGKTLSYALPIVQLLASRP 91 >At1g04470.1 68414.m00438 expressed protein EST gb|ATTS5672 comes from this gene Length = 1035 Score = 27.9 bits (59), Expect = 6.7 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = +3 Query: 33 SKRIHSLNKHLQLNPKI 83 S ++HSLNK L LNP++ Sbjct: 786 SSQLHSLNKSLSLNPRV 802 >At5g54910.1 68418.m06839 DEAD/DEAH box helicase, putative Length = 739 Score = 27.5 bits (58), Expect = 8.9 Identities = 9/21 (42%), Positives = 17/21 (80%) Frame = +2 Query: 539 QTGSGKTLAYILPAIVHINNQ 601 +TGSGKTLA+++P + ++ + Sbjct: 116 RTGSGKTLAFVIPILEKLHRE 136 >At5g05450.1 68418.m00587 DEAD/DEAH box helicase, putative (RH18) Length = 593 Score = 27.5 bits (58), Expect = 8.9 Identities = 10/23 (43%), Positives = 17/23 (73%) Frame = +2 Query: 515 WKEFSWRTQTGSGKTLAYILPAI 583 +K+ + TGSGKTLA+++P + Sbjct: 53 YKDVAVDAATGSGKTLAFVVPLV 75 >At3g16090.1 68416.m02033 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 492 Score = 27.5 bits (58), Expect = 8.9 Identities = 16/43 (37%), Positives = 21/43 (48%) Frame = -2 Query: 471 FVTHCLYTLLHIIRKICFFKVLNXIMNLNAHLQLPRDYFCTLR 343 F + LLH+ ICFF V+ MN L L R+ + T R Sbjct: 214 FYLELIRDLLHLSMYICFFFVI--FMNYGVPLHLLRELYETFR 254 >At3g02065.2 68416.m00170 DEAD/DEAH box helicase family protein contains Pfam profile: PF00270 DEAD/DEAH box helicase Length = 505 Score = 27.5 bits (58), Expect = 8.9 Identities = 14/41 (34%), Positives = 18/41 (43%) Frame = +1 Query: 382 GVEVHNXIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWP 504 G V + F P + ++T GY PTPIQ Q P Sbjct: 102 GSAVPPPVLTFTSCGLPPKLLLNLETAGYDFPTPIQMQAIP 142 >At2g25460.1 68415.m03049 expressed protein Length = 423 Score = 27.5 bits (58), Expect = 8.9 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = -1 Query: 169 ETNYRRICCLLQIWNHRFHGYY 104 E + R+CC++ WN F+ +Y Sbjct: 80 EEEFERVCCIVGPWNLSFNVFY 101 >At1g51380.1 68414.m05780 eukaryotic translation initiation factor 4A, putative / eIF-4A, putative Length = 392 Score = 27.5 bits (58), Expect = 8.9 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +1 Query: 403 IQYFEEANFPDYVQQGVKTMGYKEPTPIQ 489 I+ F++ D V +GV GYK+P+ IQ Sbjct: 21 IKSFDDMGMNDKVLRGVYDYGYKKPSEIQ 49 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,189,468 Number of Sequences: 28952 Number of extensions: 286897 Number of successful extensions: 780 Number of sequences better than 10.0: 47 Number of HSP's better than 10.0 without gapping: 704 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 772 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1467502800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -