BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060667.seq (635 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor pro... 22 4.3 DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor pro... 22 4.3 DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholi... 22 4.3 AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled rec... 22 4.3 >DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 22.2 bits (45), Expect = 4.3 Identities = 12/46 (26%), Positives = 17/46 (36%) Frame = +3 Query: 177 CPHPKPESTXTLKFTWLGXIXSMVKS*RYLSLHTXHGRTPRXARRL 314 CP P TWLG + S + Y + + R R R+ Sbjct: 353 CPDCCPSDRMVYFITWLGYVNSALNPLIYTIFNLDYRRAFRRLLRI 398 >DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 22.2 bits (45), Expect = 4.3 Identities = 12/46 (26%), Positives = 17/46 (36%) Frame = +3 Query: 177 CPHPKPESTXTLKFTWLGXIXSMVKS*RYLSLHTXHGRTPRXARRL 314 CP P TWLG + S + Y + + R R R+ Sbjct: 353 CPDCCPSDRMVYFITWLGYVNSALNPLIYTIFNLDYRRAFRRLLRI 398 >DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholine receptor beta2subunit protein. Length = 427 Score = 22.2 bits (45), Expect = 4.3 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -3 Query: 198 FPVLDVDISTILHGR 154 FPVL V I+ +LHG+ Sbjct: 8 FPVLFVIINVLLHGQ 22 >AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled receptor protein. Length = 399 Score = 22.2 bits (45), Expect = 4.3 Identities = 12/46 (26%), Positives = 17/46 (36%) Frame = +3 Query: 177 CPHPKPESTXTLKFTWLGXIXSMVKS*RYLSLHTXHGRTPRXARRL 314 CP P TWLG + S + Y + + R R R+ Sbjct: 353 CPDCCPSDRMVYFITWLGYVNSALNPLIYTIFNLDYRRAFRRLLRI 398 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 159,077 Number of Sequences: 438 Number of extensions: 3448 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19071468 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -