BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060665.seq (687 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY366246-1|AAR16204.1| 239|Homo sapiens natural killer cell inh... 32 1.7 AJ620615-1|CAF05810.2| 230|Homo sapiens killer cell immunoglobu... 32 1.7 X94609-1|CAA64317.1| 304|Homo sapiens activatory NK receptor/KK... 32 2.2 U96188-1|AAB54118.1| 202|Homo sapiens p50 cell activatory recep... 32 2.2 U24077-1|AAC50336.1| 301|Homo sapiens p58 natural killer cell r... 32 2.2 L76671-1|AAB36599.1| 304|Homo sapiens protein ( Homo sapiens nk... 32 2.2 DQ371643-1|ABD38583.1| 239|Homo sapiens killer Ig receptor prot... 32 2.2 BC127084-1|AAI27085.1| 304|Homo sapiens killer cell immunoglobu... 32 2.2 BC125147-1|AAI25148.2| 284|Homo sapiens KIR2DS4 protein protein. 32 2.2 BC108918-1|AAI08919.1| 304|Homo sapiens killer cell immunoglobu... 32 2.2 BC103693-1|AAI03694.1| 304|Homo sapiens killer cell immunoglobu... 32 2.2 BC101977-1|AAI01978.1| 304|Homo sapiens killer cell immunoglobu... 32 2.2 BC096694-1|AAH96694.1| 304|Homo sapiens killer cell immunoglobu... 32 2.2 AY523803-1|AAS73159.1| 138|Homo sapiens KIR antigen 2DS4 protein. 32 2.2 AY523801-1|AAS73158.1| 138|Homo sapiens KIR antigen 2DS4 protein. 32 2.2 AY523799-1|AAS73157.1| 152|Homo sapiens KIR antigen 2DS4 protein. 32 2.2 AY388472-1|AAR26325.1| 304|Homo sapiens natural killer cell Ig-... 32 2.2 AY366245-1|AAR16203.1| 304|Homo sapiens natural killer cell inh... 32 2.2 AY102623-1|AAM52329.1| 222|Homo sapiens KIR1D splice variant pr... 32 2.2 AJ620616-1|CAF05811.2| 230|Homo sapiens killer cell immunoglobu... 32 2.2 AJ417555-1|CAD10379.1| 297|Homo sapiens killer cell immunoglobu... 32 2.2 AJ417554-1|CAD10378.1| 232|Homo sapiens killer cell immunoglobu... 32 2.2 AF135562-1|AAD48770.1| 203|Homo sapiens p58 killer cell inhibit... 32 2.2 AF135559-1|AAD48767.1| 203|Homo sapiens p58 killer cell inhibit... 32 2.2 AF135556-1|AAD48764.1| 203|Homo sapiens p58 killer cell inhibit... 32 2.2 AF002255-1|AAB61281.1| 304|Homo sapiens cl-17 protein. 32 2.2 Y13622-1|CAA73944.1| 1587|Homo sapiens latent TGF-beta binding p... 31 5.1 X94374-1|CAA64151.1| 455|Homo sapiens HLA class I inhibitory NK... 31 5.1 X94373-1|CAA64150.1| 455|Homo sapiens HLA class I inhibitory NK... 31 5.1 X93596-1|CAA63792.1| 438|Homo sapiens NK receptor protein. 31 5.1 X93595-1|CAA63791.1| 455|Homo sapiens NK receptor protein. 31 5.1 U30272-1|AAB52520.1| 455|Homo sapiens KIR (cl-5) receptor precu... 31 5.1 L76666-1|AAB36594.1| 455|Homo sapiens protein ( Homo sapiens NK... 31 5.1 L76665-1|AAB36593.1| 455|Homo sapiens protein ( Homo sapiens Nk... 31 5.1 L41270-1|AAA69871.1| 455|Homo sapiens natural killer associated... 31 5.1 EF418613-1|ABN71372.1| 442|Homo sapiens killer cell immunoglobu... 31 5.1 EF103913-1|ABL14262.1| 442|Homo sapiens killer cell immunoglobu... 31 5.1 EF103912-1|ABL14261.1| 442|Homo sapiens killer cell immunoglobu... 31 5.1 EF103911-1|ABL14260.1| 442|Homo sapiens killer cell immunoglobu... 31 5.1 EF103910-1|ABL14259.1| 442|Homo sapiens killer cell immunoglobu... 31 5.1 DQ371637-1|ABD38582.1| 455|Homo sapiens killer Ig receptor prot... 31 5.1 DQ371628-1|ABD38581.1| 455|Homo sapiens killer Ig receptor prot... 31 5.1 DQ256504-1|ABB71822.1| 421|Homo sapiens KIR3DL2 protein. 31 5.1 BC107951-1|AAI07952.1| 455|Homo sapiens killer cell immunoglobu... 31 5.1 BC105678-1|AAI05679.1| 455|Homo sapiens killer cell immunoglobu... 31 5.1 AY789071-1|AAX23116.1| 445|Homo sapiens natural killer cell inh... 31 5.1 AY789070-1|AAX23115.1| 455|Homo sapiens natural killer cell inh... 31 5.1 AY789069-1|AAX23114.1| 445|Homo sapiens natural killer cell inh... 31 5.1 AY789068-1|AAX23113.1| 455|Homo sapiens natural killer cell inh... 31 5.1 AY789067-1|AAX23112.1| 455|Homo sapiens natural killer cell inh... 31 5.1 AY523812-1|AAS73162.1| 235|Homo sapiens KIR antigen 3DL2 protein. 31 5.1 AY523809-1|AAS73161.1| 235|Homo sapiens KIR antigen 3DL2 protein. 31 5.1 AY366256-1|AAR16214.2| 455|Homo sapiens natural killer cell inh... 31 5.1 AY059420-1|AAL27095.1| 432|Homo sapiens killer-cell immunoglobu... 31 5.1 AY059419-1|AAL27094.1| 432|Homo sapiens killer-cell immunoglobu... 31 5.1 AY059418-1|AAL27093.1| 432|Homo sapiens killer-cell immunoglobu... 31 5.1 AL133414-18|CAC40719.1| 333|Homo sapiens 1060P11.10 (killer cel... 31 5.1 AJ276125-1|CAC35466.1| 455|Homo sapiens inhibitory NK receptor ... 31 5.1 AF263617-1|AAK30062.1| 455|Homo sapiens killer cell immunoglobu... 31 5.1 AF262967-1|AAK30054.1| 455|Homo sapiens killer cell immunoglobu... 31 5.1 AF262966-1|AAK30053.1| 428|Homo sapiens killer cell immunoglobu... 31 5.1 AF262965-1|AAK30052.1| 428|Homo sapiens killer cell immunoglobu... 31 5.1 AF208686-1|AAF29518.1| 297|Homo sapiens p70 killer cell inhibit... 31 5.1 AF208685-1|AAF29517.1| 297|Homo sapiens p70 killer cell inhibit... 31 5.1 AF208684-1|AAF29516.1| 297|Homo sapiens p70 killer cell inhibit... 31 5.1 AF208683-1|AAF29515.1| 297|Homo sapiens p70 killer cell inhibit... 31 5.1 AF135558-1|AAD48766.1| 203|Homo sapiens p58 killer cell inhibit... 31 5.1 >AY366246-1|AAR16204.1| 239|Homo sapiens natural killer cell inhibitory receptor protein. Length = 239 Score = 32.3 bits (70), Expect = 1.7 Identities = 17/41 (41%), Positives = 25/41 (60%) Frame = +2 Query: 263 EGESRRAPSAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 385 +G S+ S GPM+PV A T R +VPH+ P ++ S+P Sbjct: 78 DGVSKANFSIGPMMPVLAGTYRCYSSVPHS-PYQLSAPSDP 117 >AJ620615-1|CAF05810.2| 230|Homo sapiens killer cell immunoglobulin-like receptor protein. Length = 230 Score = 32.3 bits (70), Expect = 1.7 Identities = 17/41 (41%), Positives = 25/41 (60%) Frame = +2 Query: 263 EGESRRAPSAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 385 +G S+ S GPM+PV A T R +VPH+ P ++ S+P Sbjct: 69 DGVSKANFSIGPMMPVLAGTYRCYSSVPHS-PYQLSAPSDP 108 >X94609-1|CAA64317.1| 304|Homo sapiens activatory NK receptor/KKA3 p50.3 protein. Length = 304 Score = 31.9 bits (69), Expect = 2.2 Identities = 17/41 (41%), Positives = 25/41 (60%) Frame = +2 Query: 263 EGESRRAPSAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 385 +G S+ S GPM+PV A T R +VPH+ P ++ S+P Sbjct: 78 DGVSKANFSIGPMMPVLAGTYRCYGSVPHS-PYQLSAPSDP 117 >U96188-1|AAB54118.1| 202|Homo sapiens p50 cell activatory receptor NKR-K1 protein. Length = 202 Score = 31.9 bits (69), Expect = 2.2 Identities = 17/41 (41%), Positives = 25/41 (60%) Frame = +2 Query: 263 EGESRRAPSAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 385 +G S+ S GPM+PV A T R +VPH+ P ++ S+P Sbjct: 57 DGVSKANFSIGPMMPVLAGTYRCYGSVPHS-PYQLSAPSDP 96 >U24077-1|AAC50336.1| 301|Homo sapiens p58 natural killer cell receptor precursor protein. Length = 301 Score = 31.9 bits (69), Expect = 2.2 Identities = 17/41 (41%), Positives = 25/41 (60%) Frame = +2 Query: 263 EGESRRAPSAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 385 +G S+ S GPM+PV A T R +VPH+ P ++ S+P Sbjct: 75 DGVSKANFSIGPMMPVLAGTYRCYGSVPHS-PYQLSAPSDP 114 >L76671-1|AAB36599.1| 304|Homo sapiens protein ( Homo sapiens nkat8 mRNA, complete cds. ). Length = 304 Score = 31.9 bits (69), Expect = 2.2 Identities = 17/41 (41%), Positives = 25/41 (60%) Frame = +2 Query: 263 EGESRRAPSAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 385 +G S+ S GPM+PV A T R +VPH+ P ++ S+P Sbjct: 78 DGVSKANFSIGPMMPVLAGTYRCYGSVPHS-PYQLSAPSDP 117 >DQ371643-1|ABD38583.1| 239|Homo sapiens killer Ig receptor protein. Length = 239 Score = 31.9 bits (69), Expect = 2.2 Identities = 17/41 (41%), Positives = 25/41 (60%) Frame = +2 Query: 263 EGESRRAPSAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 385 +G S+ S GPM+PV A T R +VPH+ P ++ S+P Sbjct: 78 DGVSKANFSIGPMMPVLAGTYRCYGSVPHS-PYQLSAPSDP 117 >BC127084-1|AAI27085.1| 304|Homo sapiens killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, protein. Length = 304 Score = 31.9 bits (69), Expect = 2.2 Identities = 17/41 (41%), Positives = 25/41 (60%) Frame = +2 Query: 263 EGESRRAPSAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 385 +G S+ S GPM+PV A T R +VPH+ P ++ S+P Sbjct: 78 DGVSKANFSIGPMMPVLAGTYRCYGSVPHS-PYQLSAPSDP 117 >BC125147-1|AAI25148.2| 284|Homo sapiens KIR2DS4 protein protein. Length = 284 Score = 31.9 bits (69), Expect = 2.2 Identities = 17/41 (41%), Positives = 25/41 (60%) Frame = +2 Query: 263 EGESRRAPSAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 385 +G S+ S GPM+PV A T R +VPH+ P ++ S+P Sbjct: 71 DGVSKANFSIGPMMPVLAGTYRCYGSVPHS-PYQLSAPSDP 110 >BC108918-1|AAI08919.1| 304|Homo sapiens killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, protein. Length = 304 Score = 31.9 bits (69), Expect = 2.2 Identities = 17/41 (41%), Positives = 25/41 (60%) Frame = +2 Query: 263 EGESRRAPSAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 385 +G S+ S GPM+PV A T R +VPH+ P ++ S+P Sbjct: 78 DGVSKANFSIGPMMPVLAGTYRCYGSVPHS-PYQLSAPSDP 117 >BC103693-1|AAI03694.1| 304|Homo sapiens killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, protein. Length = 304 Score = 31.9 bits (69), Expect = 2.2 Identities = 17/41 (41%), Positives = 25/41 (60%) Frame = +2 Query: 263 EGESRRAPSAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 385 +G S+ S GPM+PV A T R +VPH+ P ++ S+P Sbjct: 78 DGVSKANFSIGPMMPVLAGTYRCYGSVPHS-PYQLSAPSDP 117 >BC101977-1|AAI01978.1| 304|Homo sapiens killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, protein. Length = 304 Score = 31.9 bits (69), Expect = 2.2 Identities = 17/41 (41%), Positives = 25/41 (60%) Frame = +2 Query: 263 EGESRRAPSAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 385 +G S+ S GPM+PV A T R +VPH+ P ++ S+P Sbjct: 78 DGVSKANFSIGPMMPVLAGTYRCYGSVPHS-PYQLSAPSDP 117 >BC096694-1|AAH96694.1| 304|Homo sapiens killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, protein. Length = 304 Score = 31.9 bits (69), Expect = 2.2 Identities = 17/41 (41%), Positives = 25/41 (60%) Frame = +2 Query: 263 EGESRRAPSAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 385 +G S+ S GPM+PV A T R +VPH+ P ++ S+P Sbjct: 78 DGVSKANFSIGPMMPVLAGTYRCYGSVPHS-PYQLSAPSDP 117 >AY523803-1|AAS73159.1| 138|Homo sapiens KIR antigen 2DS4 protein. Length = 138 Score = 31.9 bits (69), Expect = 2.2 Identities = 17/41 (41%), Positives = 25/41 (60%) Frame = +2 Query: 263 EGESRRAPSAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 385 +G S+ S GPM+PV A T R +VPH+ P ++ S+P Sbjct: 13 DGVSKANFSIGPMMPVLAGTYRCYGSVPHS-PYQLSAPSDP 52 >AY523801-1|AAS73158.1| 138|Homo sapiens KIR antigen 2DS4 protein. Length = 138 Score = 31.9 bits (69), Expect = 2.2 Identities = 17/41 (41%), Positives = 25/41 (60%) Frame = +2 Query: 263 EGESRRAPSAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 385 +G S+ S GPM+PV A T R +VPH+ P ++ S+P Sbjct: 13 DGVSKANFSIGPMMPVLAGTYRCYGSVPHS-PYQLSAPSDP 52 >AY523799-1|AAS73157.1| 152|Homo sapiens KIR antigen 2DS4 protein. Length = 152 Score = 31.9 bits (69), Expect = 2.2 Identities = 17/41 (41%), Positives = 25/41 (60%) Frame = +2 Query: 263 EGESRRAPSAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 385 +G S+ S GPM+PV A T R +VPH+ P ++ S+P Sbjct: 27 DGVSKANFSIGPMMPVLAGTYRCYGSVPHS-PYQLSAPSDP 66 >AY388472-1|AAR26325.1| 304|Homo sapiens natural killer cell Ig-like receptor KIR2DS4 protein. Length = 304 Score = 31.9 bits (69), Expect = 2.2 Identities = 17/41 (41%), Positives = 25/41 (60%) Frame = +2 Query: 263 EGESRRAPSAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 385 +G S+ S GPM+PV A T R +VPH+ P ++ S+P Sbjct: 78 DGVSKANFSIGPMMPVLAGTYRCYGSVPHS-PYQLSAPSDP 117 >AY366245-1|AAR16203.1| 304|Homo sapiens natural killer cell inhibitory receptor protein. Length = 304 Score = 31.9 bits (69), Expect = 2.2 Identities = 17/41 (41%), Positives = 25/41 (60%) Frame = +2 Query: 263 EGESRRAPSAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 385 +G S+ S GPM+PV A T R +VPH+ P ++ S+P Sbjct: 78 DGVSKANFSIGPMMPVLAGTYRCYGSVPHS-PYQLSAPSDP 117 >AY102623-1|AAM52329.1| 222|Homo sapiens KIR1D splice variant protein. Length = 222 Score = 31.9 bits (69), Expect = 2.2 Identities = 17/41 (41%), Positives = 25/41 (60%) Frame = +2 Query: 263 EGESRRAPSAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 385 +G S+ S GPM+PV A T R +VPH+ P ++ S+P Sbjct: 78 DGVSKANFSIGPMMPVLAGTYRCYGSVPHS-PYQLSAPSDP 117 >AJ620616-1|CAF05811.2| 230|Homo sapiens killer cell immunoglobulin-like receptor protein. Length = 230 Score = 31.9 bits (69), Expect = 2.2 Identities = 17/41 (41%), Positives = 25/41 (60%) Frame = +2 Query: 263 EGESRRAPSAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 385 +G S+ S GPM+PV A T R +VPH+ P ++ S+P Sbjct: 69 DGVSKANFSIGPMMPVLAGTYRCYGSVPHS-PYQLSAPSDP 108 >AJ417555-1|CAD10379.1| 297|Homo sapiens killer cell immunoglobulin receptor protein. Length = 297 Score = 31.9 bits (69), Expect = 2.2 Identities = 17/41 (41%), Positives = 25/41 (60%) Frame = +2 Query: 263 EGESRRAPSAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 385 +G S+ S GPM+PV A T R +VPH+ P ++ S+P Sbjct: 71 DGVSKANFSIGPMMPVLAGTYRCYGSVPHS-PYQLSAPSDP 110 >AJ417554-1|CAD10378.1| 232|Homo sapiens killer cell immunoglobulin receptor protein. Length = 232 Score = 31.9 bits (69), Expect = 2.2 Identities = 17/41 (41%), Positives = 25/41 (60%) Frame = +2 Query: 263 EGESRRAPSAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 385 +G S+ S GPM+PV A T R +VPH+ P ++ S+P Sbjct: 71 DGVSKANFSIGPMMPVLAGTYRCYGSVPHS-PYQLSAPSDP 110 >AF135562-1|AAD48770.1| 203|Homo sapiens p58 killer cell inhibitory receptor KIR-K78 protein. Length = 203 Score = 31.9 bits (69), Expect = 2.2 Identities = 17/41 (41%), Positives = 25/41 (60%) Frame = +2 Query: 263 EGESRRAPSAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 385 +G S+ S GPM+PV A T R +VPH+ P ++ S+P Sbjct: 57 DGVSKANFSIGPMMPVLAGTYRCYGSVPHS-PYQLSAPSDP 96 >AF135559-1|AAD48767.1| 203|Homo sapiens p58 killer cell inhibitory receptor KIR-K61 protein. Length = 203 Score = 31.9 bits (69), Expect = 2.2 Identities = 17/41 (41%), Positives = 25/41 (60%) Frame = +2 Query: 263 EGESRRAPSAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 385 +G S+ S GPM+PV A T R +VPH+ P ++ S+P Sbjct: 57 DGVSKANFSIGPMMPVLAGTYRCYGSVPHS-PYQLSAPSDP 96 >AF135556-1|AAD48764.1| 203|Homo sapiens p58 killer cell inhibitory receptor KIR-K15 protein. Length = 203 Score = 31.9 bits (69), Expect = 2.2 Identities = 17/41 (41%), Positives = 25/41 (60%) Frame = +2 Query: 263 EGESRRAPSAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 385 +G S+ S GPM+PV A T R +VPH+ P ++ S+P Sbjct: 57 DGVSKANFSIGPMMPVLAGTYRCYGSVPHS-PYQLSAPSDP 96 >AF002255-1|AAB61281.1| 304|Homo sapiens cl-17 protein. Length = 304 Score = 31.9 bits (69), Expect = 2.2 Identities = 17/41 (41%), Positives = 25/41 (60%) Frame = +2 Query: 263 EGESRRAPSAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 385 +G S+ S GPM+PV A T R +VPH+ P ++ S+P Sbjct: 78 DGVSKANFSIGPMMPVLAGTYRCYGSVPHS-PYQLSAPSDP 117 >Y13622-1|CAA73944.1| 1587|Homo sapiens latent TGF-beta binding protein-4 protein. Length = 1587 Score = 30.7 bits (66), Expect = 5.1 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = +2 Query: 269 ESRRAPSAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEPRCC 394 E R P GP LP+ ++ T +P + PSS P+ C Sbjct: 478 EPRPDPRPGPELPLPSIPAWTGPEIPESGPSSGMCQRNPQVC 519 >X94374-1|CAA64151.1| 455|Homo sapiens HLA class I inhibitory NK receptor protein. Length = 455 Score = 30.7 bits (66), Expect = 5.1 Identities = 16/41 (39%), Positives = 25/41 (60%) Frame = +2 Query: 263 EGESRRAPSAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 385 +G S+ S GP++PV A T R +VPH+ P ++ S+P Sbjct: 173 DGVSKANFSIGPLMPVLAGTYRCYGSVPHS-PYQLSAPSDP 212 >X94373-1|CAA64150.1| 455|Homo sapiens HLA class I inhibitory NK receptor protein. Length = 455 Score = 30.7 bits (66), Expect = 5.1 Identities = 16/41 (39%), Positives = 25/41 (60%) Frame = +2 Query: 263 EGESRRAPSAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 385 +G S+ S GP++PV A T R +VPH+ P ++ S+P Sbjct: 173 DGVSKANFSIGPLMPVLAGTYRCYGSVPHS-PYQLSAPSDP 212 >X93596-1|CAA63792.1| 438|Homo sapiens NK receptor protein. Length = 438 Score = 30.7 bits (66), Expect = 5.1 Identities = 16/41 (39%), Positives = 25/41 (60%) Frame = +2 Query: 263 EGESRRAPSAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 385 +G S+ S GP++PV A T R +VPH+ P ++ S+P Sbjct: 173 DGVSKANFSIGPLMPVLAGTYRCYGSVPHS-PYQLSAPSDP 212 >X93595-1|CAA63791.1| 455|Homo sapiens NK receptor protein. Length = 455 Score = 30.7 bits (66), Expect = 5.1 Identities = 16/41 (39%), Positives = 25/41 (60%) Frame = +2 Query: 263 EGESRRAPSAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 385 +G S+ S GP++PV A T R +VPH+ P ++ S+P Sbjct: 173 DGVSKANFSIGPLMPVLAGTYRCYGSVPHS-PYQLSAPSDP 212 >U30272-1|AAB52520.1| 455|Homo sapiens KIR (cl-5) receptor precursor protein protein. Length = 455 Score = 30.7 bits (66), Expect = 5.1 Identities = 16/41 (39%), Positives = 25/41 (60%) Frame = +2 Query: 263 EGESRRAPSAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 385 +G S+ S GP++PV A T R +VPH+ P ++ S+P Sbjct: 173 DGVSKANFSIGPLMPVLAGTYRCYGSVPHS-PYQLSAPSDP 212 >L76666-1|AAB36594.1| 455|Homo sapiens protein ( Homo sapiens NKAT4b mRNA, complete cds. ). Length = 455 Score = 30.7 bits (66), Expect = 5.1 Identities = 16/41 (39%), Positives = 25/41 (60%) Frame = +2 Query: 263 EGESRRAPSAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 385 +G S+ S GP++PV A T R +VPH+ P ++ S+P Sbjct: 173 DGVSKANFSIGPLMPVLAGTYRCYGSVPHS-PYQLSAPSDP 212 >L76665-1|AAB36593.1| 455|Homo sapiens protein ( Homo sapiens Nkat4a mRNA, complete cds. ). Length = 455 Score = 30.7 bits (66), Expect = 5.1 Identities = 16/41 (39%), Positives = 25/41 (60%) Frame = +2 Query: 263 EGESRRAPSAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 385 +G S+ S GP++PV A T R +VPH+ P ++ S+P Sbjct: 173 DGVSKANFSIGPLMPVLAGTYRCYGSVPHS-PYQLSAPSDP 212 >L41270-1|AAA69871.1| 455|Homo sapiens natural killer associated transcript 4 protein. Length = 455 Score = 30.7 bits (66), Expect = 5.1 Identities = 16/41 (39%), Positives = 25/41 (60%) Frame = +2 Query: 263 EGESRRAPSAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 385 +G S+ S GP++PV A T R +VPH+ P ++ S+P Sbjct: 173 DGVSKANFSIGPLMPVLAGTYRCYGSVPHS-PYQLSAPSDP 212 >EF418613-1|ABN71372.1| 442|Homo sapiens killer cell immunoglobulin-like receptor protein. Length = 442 Score = 30.7 bits (66), Expect = 5.1 Identities = 16/41 (39%), Positives = 25/41 (60%) Frame = +2 Query: 263 EGESRRAPSAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 385 +G S+ S GP++PV A T R +VPH+ P ++ S+P Sbjct: 161 DGVSKANFSIGPLMPVLAGTYRCYGSVPHS-PYQLSAPSDP 200 >EF103913-1|ABL14262.1| 442|Homo sapiens killer cell immunoglobulin-like receptor 3DL2 protein. Length = 442 Score = 30.7 bits (66), Expect = 5.1 Identities = 16/41 (39%), Positives = 25/41 (60%) Frame = +2 Query: 263 EGESRRAPSAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 385 +G S+ S GP++PV A T R +VPH+ P ++ S+P Sbjct: 161 DGVSKANFSIGPLMPVLAGTYRCYGSVPHS-PYQLSAPSDP 200 >EF103912-1|ABL14261.1| 442|Homo sapiens killer cell immunoglobulin-like receptor 3DL2 protein. Length = 442 Score = 30.7 bits (66), Expect = 5.1 Identities = 16/41 (39%), Positives = 25/41 (60%) Frame = +2 Query: 263 EGESRRAPSAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 385 +G S+ S GP++PV A T R +VPH+ P ++ S+P Sbjct: 161 DGVSKANFSIGPLMPVLAGTYRCYGSVPHS-PYQLSAPSDP 200 >EF103911-1|ABL14260.1| 442|Homo sapiens killer cell immunoglobulin-like receptor 3DL2 protein. Length = 442 Score = 30.7 bits (66), Expect = 5.1 Identities = 16/41 (39%), Positives = 25/41 (60%) Frame = +2 Query: 263 EGESRRAPSAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 385 +G S+ S GP++PV A T R +VPH+ P ++ S+P Sbjct: 161 DGVSKANFSIGPLMPVLAGTYRCYGSVPHS-PYQLSAPSDP 200 >EF103910-1|ABL14259.1| 442|Homo sapiens killer cell immunoglobulin-like receptor 3DL2 protein. Length = 442 Score = 30.7 bits (66), Expect = 5.1 Identities = 16/41 (39%), Positives = 25/41 (60%) Frame = +2 Query: 263 EGESRRAPSAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 385 +G S+ S GP++PV A T R +VPH+ P ++ S+P Sbjct: 161 DGVSKANFSIGPLMPVLAGTYRCYGSVPHS-PYQLSAPSDP 200 >DQ371637-1|ABD38582.1| 455|Homo sapiens killer Ig receptor protein. Length = 455 Score = 30.7 bits (66), Expect = 5.1 Identities = 16/41 (39%), Positives = 25/41 (60%) Frame = +2 Query: 263 EGESRRAPSAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 385 +G S+ S GP++PV A T R +VPH+ P ++ S+P Sbjct: 173 DGVSKANFSIGPLMPVLAGTYRCYGSVPHS-PYQLSAPSDP 212 >DQ371628-1|ABD38581.1| 455|Homo sapiens killer Ig receptor protein. Length = 455 Score = 30.7 bits (66), Expect = 5.1 Identities = 16/41 (39%), Positives = 25/41 (60%) Frame = +2 Query: 263 EGESRRAPSAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 385 +G S+ S GP++PV A T R +VPH+ P ++ S+P Sbjct: 173 DGVSKANFSIGPLMPVLAGTYRCYGSVPHS-PYQLSAPSDP 212 >DQ256504-1|ABB71822.1| 421|Homo sapiens KIR3DL2 protein. Length = 421 Score = 30.7 bits (66), Expect = 5.1 Identities = 16/41 (39%), Positives = 25/41 (60%) Frame = +2 Query: 263 EGESRRAPSAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 385 +G S+ S GP++PV A T R +VPH+ P ++ S+P Sbjct: 150 DGVSKANFSIGPLMPVLAGTYRCYGSVPHS-PYQLSAPSDP 189 >BC107951-1|AAI07952.1| 455|Homo sapiens killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, protein. Length = 455 Score = 30.7 bits (66), Expect = 5.1 Identities = 16/41 (39%), Positives = 25/41 (60%) Frame = +2 Query: 263 EGESRRAPSAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 385 +G S+ S GP++PV A T R +VPH+ P ++ S+P Sbjct: 173 DGVSKANFSIGPLMPVLAGTYRCYGSVPHS-PYQLSAPSDP 212 >BC105678-1|AAI05679.1| 455|Homo sapiens killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, protein. Length = 455 Score = 30.7 bits (66), Expect = 5.1 Identities = 16/41 (39%), Positives = 25/41 (60%) Frame = +2 Query: 263 EGESRRAPSAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 385 +G S+ S GP++PV A T R +VPH+ P ++ S+P Sbjct: 173 DGVSKANFSIGPLMPVLAGTYRCYGSVPHS-PYQLSAPSDP 212 >AY789071-1|AAX23116.1| 445|Homo sapiens natural killer cell inhibitory receptor protein. Length = 445 Score = 30.7 bits (66), Expect = 5.1 Identities = 16/41 (39%), Positives = 25/41 (60%) Frame = +2 Query: 263 EGESRRAPSAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 385 +G S+ S GP++PV A T R +VPH+ P ++ S+P Sbjct: 163 DGVSKANFSIGPLMPVLAGTYRCYGSVPHS-PYQLSAPSDP 202 >AY789070-1|AAX23115.1| 455|Homo sapiens natural killer cell inhibitory receptor protein. Length = 455 Score = 30.7 bits (66), Expect = 5.1 Identities = 16/41 (39%), Positives = 25/41 (60%) Frame = +2 Query: 263 EGESRRAPSAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 385 +G S+ S GP++PV A T R +VPH+ P ++ S+P Sbjct: 173 DGVSKANFSIGPLMPVLAGTYRCYGSVPHS-PYQLSAPSDP 212 >AY789069-1|AAX23114.1| 445|Homo sapiens natural killer cell inhibitory receptor protein. Length = 445 Score = 30.7 bits (66), Expect = 5.1 Identities = 16/41 (39%), Positives = 25/41 (60%) Frame = +2 Query: 263 EGESRRAPSAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 385 +G S+ S GP++PV A T R +VPH+ P ++ S+P Sbjct: 163 DGVSKANFSIGPLMPVLAGTYRCYGSVPHS-PYQLSAPSDP 202 >AY789068-1|AAX23113.1| 455|Homo sapiens natural killer cell inhibitory receptor protein. Length = 455 Score = 30.7 bits (66), Expect = 5.1 Identities = 16/41 (39%), Positives = 25/41 (60%) Frame = +2 Query: 263 EGESRRAPSAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 385 +G S+ S GP++PV A T R +VPH+ P ++ S+P Sbjct: 173 DGVSKANFSIGPLMPVLAGTYRCYGSVPHS-PYQLSAPSDP 212 >AY789067-1|AAX23112.1| 455|Homo sapiens natural killer cell inhibitory receptor protein. Length = 455 Score = 30.7 bits (66), Expect = 5.1 Identities = 16/41 (39%), Positives = 25/41 (60%) Frame = +2 Query: 263 EGESRRAPSAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 385 +G S+ S GP++PV A T R +VPH+ P ++ S+P Sbjct: 173 DGVSKANFSIGPLMPVLAGTYRCYGSVPHS-PYQLSAPSDP 212 >AY523812-1|AAS73162.1| 235|Homo sapiens KIR antigen 3DL2 protein. Length = 235 Score = 30.7 bits (66), Expect = 5.1 Identities = 16/41 (39%), Positives = 25/41 (60%) Frame = +2 Query: 263 EGESRRAPSAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 385 +G S+ S GP++PV A T R +VPH+ P ++ S+P Sbjct: 107 DGVSKANFSIGPLMPVLAGTYRCYGSVPHS-PYQLSAPSDP 146 >AY523809-1|AAS73161.1| 235|Homo sapiens KIR antigen 3DL2 protein. Length = 235 Score = 30.7 bits (66), Expect = 5.1 Identities = 16/41 (39%), Positives = 25/41 (60%) Frame = +2 Query: 263 EGESRRAPSAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 385 +G S+ S GP++PV A T R +VPH+ P ++ S+P Sbjct: 107 DGVSKANFSIGPLMPVLAGTYRCYGSVPHS-PYQLSAPSDP 146 >AY366256-1|AAR16214.2| 455|Homo sapiens natural killer cell inhibitory receptor protein. Length = 455 Score = 30.7 bits (66), Expect = 5.1 Identities = 16/41 (39%), Positives = 25/41 (60%) Frame = +2 Query: 263 EGESRRAPSAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 385 +G S+ S GP++PV A T R +VPH+ P ++ S+P Sbjct: 173 DGVSKANFSIGPLMPVLAGTYRCYGSVPHS-PYQLSAPSDP 212 >AY059420-1|AAL27095.1| 432|Homo sapiens killer-cell immunoglobulin-like receptor protein. Length = 432 Score = 30.7 bits (66), Expect = 5.1 Identities = 16/41 (39%), Positives = 25/41 (60%) Frame = +2 Query: 263 EGESRRAPSAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 385 +G S+ S GP++PV A T R +VPH+ P ++ S+P Sbjct: 150 DGVSKANFSIGPLMPVLAGTYRCYGSVPHS-PYQLSAPSDP 189 >AY059419-1|AAL27094.1| 432|Homo sapiens killer-cell immunoglobulin-like receptor protein. Length = 432 Score = 30.7 bits (66), Expect = 5.1 Identities = 16/41 (39%), Positives = 25/41 (60%) Frame = +2 Query: 263 EGESRRAPSAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 385 +G S+ S GP++PV A T R +VPH+ P ++ S+P Sbjct: 150 DGVSKANFSIGPLMPVLAGTYRCYGSVPHS-PYQLSAPSDP 189 >AY059418-1|AAL27093.1| 432|Homo sapiens killer-cell immunoglobulin-like receptor protein. Length = 432 Score = 30.7 bits (66), Expect = 5.1 Identities = 16/41 (39%), Positives = 25/41 (60%) Frame = +2 Query: 263 EGESRRAPSAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 385 +G S+ S GP++PV A T R +VPH+ P ++ S+P Sbjct: 150 DGVSKANFSIGPLMPVLAGTYRCYGSVPHS-PYQLSAPSDP 189 >AL133414-18|CAC40719.1| 333|Homo sapiens 1060P11.10 (killer cell immunoglobulin-like receptor, three domains, long cytop protein. Length = 333 Score = 30.7 bits (66), Expect = 5.1 Identities = 16/41 (39%), Positives = 25/41 (60%) Frame = +2 Query: 263 EGESRRAPSAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 385 +G S+ S GP++PV A T R +VPH+ P ++ S+P Sbjct: 173 DGVSKANFSIGPLMPVLAGTYRCYGSVPHS-PYQLSAPSDP 212 >AJ276125-1|CAC35466.1| 455|Homo sapiens inhibitory NK receptor protein. Length = 455 Score = 30.7 bits (66), Expect = 5.1 Identities = 16/41 (39%), Positives = 25/41 (60%) Frame = +2 Query: 263 EGESRRAPSAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 385 +G S+ S GP++PV A T R +VPH+ P ++ S+P Sbjct: 173 DGVSKANFSIGPLMPVLAGTYRCYGSVPHS-PYQLSAPSDP 212 >AF263617-1|AAK30062.1| 455|Homo sapiens killer cell immunoglobulin-like receptor 3DL2 protein. Length = 455 Score = 30.7 bits (66), Expect = 5.1 Identities = 16/41 (39%), Positives = 25/41 (60%) Frame = +2 Query: 263 EGESRRAPSAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 385 +G S+ S GP++PV A T R +VPH+ P ++ S+P Sbjct: 173 DGVSKANFSIGPLMPVLAGTYRCYGSVPHS-PYQLSAPSDP 212 >AF262967-1|AAK30054.1| 455|Homo sapiens killer cell immunoglobulin-like receptor 3DL2 protein. Length = 455 Score = 30.7 bits (66), Expect = 5.1 Identities = 16/41 (39%), Positives = 25/41 (60%) Frame = +2 Query: 263 EGESRRAPSAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 385 +G S+ S GP++PV A T R +VPH+ P ++ S+P Sbjct: 173 DGVSKANFSIGPLMPVLAGTYRCYGSVPHS-PYQLSAPSDP 212 >AF262966-1|AAK30053.1| 428|Homo sapiens killer cell immunoglobulin-like receptor 3DL2 protein. Length = 428 Score = 30.7 bits (66), Expect = 5.1 Identities = 16/41 (39%), Positives = 25/41 (60%) Frame = +2 Query: 263 EGESRRAPSAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 385 +G S+ S GP++PV A T R +VPH+ P ++ S+P Sbjct: 146 DGVSKANFSIGPLMPVLAGTYRCYGSVPHS-PYQLSAPSDP 185 >AF262965-1|AAK30052.1| 428|Homo sapiens killer cell immunoglobulin-like receptor 3DL2 protein. Length = 428 Score = 30.7 bits (66), Expect = 5.1 Identities = 16/41 (39%), Positives = 25/41 (60%) Frame = +2 Query: 263 EGESRRAPSAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 385 +G S+ S GP++PV A T R +VPH+ P ++ S+P Sbjct: 146 DGVSKANFSIGPLMPVLAGTYRCYGSVPHS-PYQLSAPSDP 185 >AF208686-1|AAF29518.1| 297|Homo sapiens p70 killer cell inhibitory receptor protein. Length = 297 Score = 30.7 bits (66), Expect = 5.1 Identities = 16/41 (39%), Positives = 25/41 (60%) Frame = +2 Query: 263 EGESRRAPSAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 385 +G S+ S GP++PV A T R +VPH+ P ++ S+P Sbjct: 152 DGVSKANFSIGPLMPVLAGTYRCYGSVPHS-PYQLSAPSDP 191 >AF208685-1|AAF29517.1| 297|Homo sapiens p70 killer cell inhibitory receptor protein. Length = 297 Score = 30.7 bits (66), Expect = 5.1 Identities = 16/41 (39%), Positives = 25/41 (60%) Frame = +2 Query: 263 EGESRRAPSAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 385 +G S+ S GP++PV A T R +VPH+ P ++ S+P Sbjct: 152 DGVSKANFSIGPLMPVLAGTYRCYGSVPHS-PYQLSAPSDP 191 >AF208684-1|AAF29516.1| 297|Homo sapiens p70 killer cell inhibitory receptor protein. Length = 297 Score = 30.7 bits (66), Expect = 5.1 Identities = 16/41 (39%), Positives = 25/41 (60%) Frame = +2 Query: 263 EGESRRAPSAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 385 +G S+ S GP++PV A T R +VPH+ P ++ S+P Sbjct: 152 DGVSKANFSIGPLMPVLAGTYRCYGSVPHS-PYQLSAPSDP 191 >AF208683-1|AAF29515.1| 297|Homo sapiens p70 killer cell inhibitory receptor protein. Length = 297 Score = 30.7 bits (66), Expect = 5.1 Identities = 16/41 (39%), Positives = 25/41 (60%) Frame = +2 Query: 263 EGESRRAPSAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 385 +G S+ S GP++PV A T R +VPH+ P ++ S+P Sbjct: 152 DGVSKANFSIGPLMPVLAGTYRCYGSVPHS-PYQLSAPSDP 191 >AF135558-1|AAD48766.1| 203|Homo sapiens p58 killer cell inhibitory receptor KIR-K39 protein. Length = 203 Score = 30.7 bits (66), Expect = 5.1 Identities = 16/41 (39%), Positives = 25/41 (60%) Frame = +2 Query: 263 EGESRRAPSAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 385 +G S+ S GP++PV A T R +VPH+ P ++ S+P Sbjct: 57 DGVSKANFSIGPLMPVLAGTYRCYGSVPHS-PYQLSAPSDP 96 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 94,918,289 Number of Sequences: 237096 Number of extensions: 1928250 Number of successful extensions: 5212 Number of sequences better than 10.0: 67 Number of HSP's better than 10.0 without gapping: 5017 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5210 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 7839245960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -